Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 650210..650937 | Replicon | chromosome |
| Accession | NZ_CP124467 | ||
| Organism | Escherichia coli strain AVS0747 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | QJB08_RS03235 | Protein ID | WP_000550189.1 |
| Coordinates | 650210..650524 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJB08_RS03240 | Protein ID | WP_000560269.1 |
| Coordinates | 650521..650937 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB08_RS03210 (645645) | 645645..646907 | - | 1263 | WP_000608644.1 | IS1380-like element ISEcp1 family transposase | - |
| QJB08_RS03215 (647096) | 647096..647353 | - | 258 | Protein_630 | Gfo/Idh/MocA family oxidoreductase | - |
| QJB08_RS03220 (647432) | 647432..648124 | - | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
| QJB08_RS03225 (648201) | 648201..648704 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| QJB08_RS03230 (648789) | 648789..649925 | + | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| QJB08_RS03235 (650210) | 650210..650524 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| QJB08_RS03240 (650521) | 650521..650937 | + | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| QJB08_RS03245 (650982) | 650982..653000 | - | 2019 | WP_000121413.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| QJB08_RS03250 (653226) | 653226..655577 | - | 2352 | WP_078232978.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | blaCTX-M-1 | - | 644482..646907 | 2425 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T280383 WP_000550189.1 NZ_CP124467:650210-650524 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT280383 WP_000560269.1 NZ_CP124467:650521-650937 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|