Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 47827..48091 Replicon plasmid pAVS0947-B
Accession NZ_CP124462
Organism Escherichia coli strain AVS0947

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag QJP79_RS25355 Protein ID WP_001331364.1
Coordinates 47939..48091 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 47827..47884 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP79_RS25340 (43066) 43066..45357 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
QJP79_RS25345 (45350) 45350..46420 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
QJP79_RS25350 (46439) 46439..47647 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (47827) 47827..47884 - 58 NuclAT_0 - Antitoxin
- (47827) 47827..47884 - 58 NuclAT_0 - Antitoxin
- (47827) 47827..47884 - 58 NuclAT_0 - Antitoxin
- (47827) 47827..47884 - 58 NuclAT_0 - Antitoxin
QJP79_RS25355 (47939) 47939..48091 + 153 WP_001331364.1 Hok/Gef family protein Toxin
QJP79_RS25360 (48163) 48163..48414 - 252 WP_001291964.1 hypothetical protein -
QJP79_RS25365 (48913) 48913..49008 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QJP79_RS25370 (49073) 49073..49249 - 177 WP_001054904.1 hypothetical protein -
QJP79_RS25375 (49773) 49773..50792 + 1020 WP_000875212.1 IS110 family transposase -
QJP79_RS25380 (51073) 51073..51282 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QJP79_RS25385 (51354) 51354..52004 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..95665 95665
- flank IS/Tn - - 49773..50792 1019


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T280376 WP_001331364.1 NZ_CP124462:47939-48091 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT280376 NZ_CP124462:c47884-47827 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References