Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47827..48091 | Replicon | plasmid pAVS0947-B |
| Accession | NZ_CP124462 | ||
| Organism | Escherichia coli strain AVS0947 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | QJP79_RS25355 | Protein ID | WP_001331364.1 |
| Coordinates | 47939..48091 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 47827..47884 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP79_RS25340 (43066) | 43066..45357 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| QJP79_RS25345 (45350) | 45350..46420 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| QJP79_RS25350 (46439) | 46439..47647 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (47827) | 47827..47884 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (47827) | 47827..47884 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (47827) | 47827..47884 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (47827) | 47827..47884 | - | 58 | NuclAT_0 | - | Antitoxin |
| QJP79_RS25355 (47939) | 47939..48091 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| QJP79_RS25360 (48163) | 48163..48414 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| QJP79_RS25365 (48913) | 48913..49008 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| QJP79_RS25370 (49073) | 49073..49249 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| QJP79_RS25375 (49773) | 49773..50792 | + | 1020 | WP_000875212.1 | IS110 family transposase | - |
| QJP79_RS25380 (51073) | 51073..51282 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QJP79_RS25385 (51354) | 51354..52004 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..95665 | 95665 | |
| - | flank | IS/Tn | - | - | 49773..50792 | 1019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T280376 WP_001331364.1 NZ_CP124462:47939-48091 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT280376 NZ_CP124462:c47884-47827 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|