Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 88217..88456 | Replicon | plasmid pAVS0947-A |
| Accession | NZ_CP124461 | ||
| Organism | Escherichia coli strain AVS0947 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJP79_RS24935 | Protein ID | WP_023144756.1 |
| Coordinates | 88322..88456 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 88217..88277 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP79_RS24905 (84008) | 84008..84568 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| QJP79_RS24910 (84699) | 84699..84911 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| QJP79_RS24915 (85470) | 85470..85895 | + | 426 | WP_000422741.1 | transposase | - |
| QJP79_RS24920 (85892) | 85892..86242 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP79_RS24925 (86273) | 86273..87886 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJP79_RS24930 (87964) | 87964..88250 | + | 287 | Protein_98 | DUF2726 domain-containing protein | - |
| - (88217) | 88217..88277 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (88217) | 88217..88277 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (88217) | 88217..88277 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (88217) | 88217..88277 | - | 61 | NuclAT_2 | - | Antitoxin |
| QJP79_RS24935 (88322) | 88322..88456 | + | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| QJP79_RS24940 (88753) | 88753..89007 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJP79_RS24945 (89244) | 89244..89318 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJP79_RS24950 (89311) | 89311..90168 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJP79_RS24955 (91108) | 91108..91752 | + | 645 | WP_100620350.1 | CPBP family intramembrane metalloprotease | - |
| QJP79_RS24960 (91845) | 91845..92102 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJP79_RS24965 (92035) | 92035..92436 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaTEM-1B | senB | 1..110076 | 110076 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280370 WP_023144756.1 NZ_CP124461:88322-88456 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280370 NZ_CP124461:c88277-88217 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|