Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 65212..65454 | Replicon | plasmid pAVS0947-A |
| Accession | NZ_CP124461 | ||
| Organism | Escherichia coli strain AVS0947 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP79_RS24815 | Protein ID | WP_001372321.1 |
| Coordinates | 65329..65454 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 65212..65252 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP79_RS24790 (60408) | 60408..62366 | + | 1959 | WP_283201915.1 | ParB/RepB/Spo0J family partition protein | - |
| QJP79_RS24795 (62421) | 62421..62855 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| QJP79_RS24800 (62852) | 62852..63614 | + | 763 | Protein_72 | plasmid SOS inhibition protein A | - |
| - (63583) | 63583..63769 | + | 187 | NuclAT_0 | - | - |
| - (63583) | 63583..63769 | + | 187 | NuclAT_0 | - | - |
| - (63583) | 63583..63769 | + | 187 | NuclAT_0 | - | - |
| - (63583) | 63583..63769 | + | 187 | NuclAT_0 | - | - |
| QJP79_RS24805 (63815) | 63815..65185 | + | 1371 | Protein_73 | IS3-like element IS150 family transposase | - |
| - (65212) | 65212..65252 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (65212) | 65212..65252 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (65212) | 65212..65252 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (65212) | 65212..65252 | + | 41 | NuclAT_1 | - | Antitoxin |
| QJP79_RS24810 (65238) | 65238..65387 | + | 150 | Protein_74 | plasmid maintenance protein Mok | - |
| QJP79_RS24815 (65329) | 65329..65454 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP79_RS24820 (65674) | 65674..65904 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| QJP79_RS24825 (65902) | 65902..66075 | - | 174 | Protein_77 | hypothetical protein | - |
| QJP79_RS24830 (66374) | 66374..66660 | + | 287 | Protein_78 | hypothetical protein | - |
| QJP79_RS24835 (66778) | 66778..66903 | + | 126 | Protein_79 | DUF945 domain-containing protein | - |
| QJP79_RS24840 (66959) | 66959..67657 | + | 699 | Protein_80 | IS1 family transposase | - |
| QJP79_RS24845 (67801) | 67801..68085 | + | 285 | WP_001617873.1 | type-F conjugative transfer system pilin chaperone TraQ | - |
| QJP79_RS24850 (68072) | 68072..68617 | + | 546 | WP_000059829.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
| QJP79_RS24855 (68547) | 68547..68894 | + | 348 | WP_071571857.1 | P-type conjugative transfer protein TrbJ | - |
| QJP79_RS24860 (68875) | 68875..69267 | + | 393 | WP_000659962.1 | F-type conjugal transfer protein TrbF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaTEM-1B | senB | 1..110076 | 110076 | |
| - | inside | IScluster/Tn | - | - | 63815..67657 | 3842 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T280367 WP_001372321.1 NZ_CP124461:65329-65454 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT280367 NZ_CP124461:65212-65252 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
