Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4904959..4905180 Replicon chromosome
Accession NZ_CP124460
Organism Escherichia coli strain AVS0947

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP79_RS23995 Protein ID WP_001531632.1
Coordinates 4904959..4905066 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4905114..4905180 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP79_RS23970 (4900803) 4900803..4901885 + 1083 WP_283201901.1 peptide chain release factor 1 -
QJP79_RS23975 (4901885) 4901885..4902718 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP79_RS23980 (4902715) 4902715..4903107 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP79_RS23985 (4903111) 4903111..4903920 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP79_RS23990 (4903956) 4903956..4904810 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP79_RS23995 (4904959) 4904959..4905066 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4905116) 4905116..4905179 + 64 NuclAT_12 - -
- (4905116) 4905116..4905179 + 64 NuclAT_12 - -
- (4905116) 4905116..4905179 + 64 NuclAT_12 - -
- (4905116) 4905116..4905179 + 64 NuclAT_12 - -
- (4905116) 4905116..4905179 + 64 NuclAT_13 - -
- (4905116) 4905116..4905179 + 64 NuclAT_13 - -
- (4905116) 4905116..4905179 + 64 NuclAT_13 - -
- (4905116) 4905116..4905179 + 64 NuclAT_13 - -
- (4905116) 4905116..4905179 + 64 NuclAT_14 - -
- (4905116) 4905116..4905179 + 64 NuclAT_14 - -
- (4905116) 4905116..4905179 + 64 NuclAT_14 - -
- (4905116) 4905116..4905179 + 64 NuclAT_14 - -
- (4905116) 4905116..4905179 + 64 NuclAT_15 - -
- (4905116) 4905116..4905179 + 64 NuclAT_15 - -
- (4905116) 4905116..4905179 + 64 NuclAT_15 - -
- (4905116) 4905116..4905179 + 64 NuclAT_15 - -
- (4905116) 4905116..4905179 + 64 NuclAT_16 - -
- (4905116) 4905116..4905179 + 64 NuclAT_16 - -
- (4905116) 4905116..4905179 + 64 NuclAT_16 - -
- (4905116) 4905116..4905179 + 64 NuclAT_16 - -
- (4905116) 4905116..4905179 + 64 NuclAT_17 - -
- (4905116) 4905116..4905179 + 64 NuclAT_17 - -
- (4905116) 4905116..4905179 + 64 NuclAT_17 - -
- (4905116) 4905116..4905179 + 64 NuclAT_17 - -
- (4905114) 4905114..4905180 + 67 NuclAT_10 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_10 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_10 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_10 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_5 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_5 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_5 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_5 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_6 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_6 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_6 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_6 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_7 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_7 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_7 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_7 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_8 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_8 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_8 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_8 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_9 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_9 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_9 - Antitoxin
- (4905114) 4905114..4905180 + 67 NuclAT_9 - Antitoxin
- (4905116) 4905116..4905181 + 66 NuclAT_18 - -
- (4905116) 4905116..4905181 + 66 NuclAT_18 - -
- (4905116) 4905116..4905181 + 66 NuclAT_18 - -
- (4905116) 4905116..4905181 + 66 NuclAT_18 - -
- (4905116) 4905116..4905181 + 66 NuclAT_19 - -
- (4905116) 4905116..4905181 + 66 NuclAT_19 - -
- (4905116) 4905116..4905181 + 66 NuclAT_19 - -
- (4905116) 4905116..4905181 + 66 NuclAT_19 - -
- (4905116) 4905116..4905181 + 66 NuclAT_20 - -
- (4905116) 4905116..4905181 + 66 NuclAT_20 - -
- (4905116) 4905116..4905181 + 66 NuclAT_20 - -
- (4905116) 4905116..4905181 + 66 NuclAT_20 - -
- (4905116) 4905116..4905181 + 66 NuclAT_21 - -
- (4905116) 4905116..4905181 + 66 NuclAT_21 - -
- (4905116) 4905116..4905181 + 66 NuclAT_21 - -
- (4905116) 4905116..4905181 + 66 NuclAT_21 - -
- (4905116) 4905116..4905181 + 66 NuclAT_22 - -
- (4905116) 4905116..4905181 + 66 NuclAT_22 - -
- (4905116) 4905116..4905181 + 66 NuclAT_22 - -
- (4905116) 4905116..4905181 + 66 NuclAT_22 - -
- (4905116) 4905116..4905181 + 66 NuclAT_23 - -
- (4905116) 4905116..4905181 + 66 NuclAT_23 - -
- (4905116) 4905116..4905181 + 66 NuclAT_23 - -
- (4905116) 4905116..4905181 + 66 NuclAT_23 - -
QJP79_RS24000 (4905471) 4905471..4906571 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP79_RS24005 (4906841) 4906841..4907080 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP79_RS24010 (4907229) 4907229..4907924 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP79_RS24015 (4907968) 4907968..4908321 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP79_RS24020 (4908506) 4908506..4909900 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280362 WP_001531632.1 NZ_CP124460:c4905066-4904959 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280362 NZ_CP124460:4905114-4905180 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References