Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 4056274..4056953 | Replicon | chromosome |
Accession | NZ_CP124460 | ||
Organism | Escherichia coli strain AVS0947 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QJP79_RS19630 | Protein ID | WP_000057523.1 |
Coordinates | 4056274..4056576 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QJP79_RS19635 | Protein ID | WP_000806442.1 |
Coordinates | 4056612..4056953 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP79_RS19605 (4051650) | 4051650..4053302 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
QJP79_RS19610 (4053340) | 4053340..4053843 | - | 504 | WP_000667000.1 | hypothetical protein | - |
QJP79_RS19615 (4053840) | 4053840..4054496 | - | 657 | WP_015674862.1 | hypothetical protein | - |
QJP79_RS19620 (4054664) | 4054664..4055143 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QJP79_RS19625 (4055347) | 4055347..4056141 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QJP79_RS19630 (4056274) | 4056274..4056576 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJP79_RS19635 (4056612) | 4056612..4056953 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QJP79_RS19640 (4057011) | 4057011..4059515 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QJP79_RS19645 (4059777) | 4059777..4060709 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280361 WP_000057523.1 NZ_CP124460:4056274-4056576 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|