Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2917241..2917843 | Replicon | chromosome |
| Accession | NZ_CP124460 | ||
| Organism | Escherichia coli strain AVS0947 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP79_RS14220 | Protein ID | WP_000897302.1 |
| Coordinates | 2917241..2917552 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP79_RS14225 | Protein ID | WP_000356397.1 |
| Coordinates | 2917553..2917843 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP79_RS14195 (2913155) | 2913155..2913754 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QJP79_RS14200 (2913748) | 2913748..2914620 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJP79_RS14205 (2914617) | 2914617..2915054 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP79_RS14210 (2915099) | 2915099..2916040 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP79_RS14215 (2916104) | 2916104..2917012 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP79_RS14220 (2917241) | 2917241..2917552 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP79_RS14225 (2917553) | 2917553..2917843 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP79_RS14230 (2918202) | 2918202..2918480 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP79_RS14235 (2918877) | 2918877..2919095 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP79_RS14240 (2919280) | 2919280..2920020 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP79_RS14245 (2920045) | 2920045..2920893 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP79_RS14250 (2921183) | 2921183..2921425 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP79_RS14255 (2921607) | 2921607..2922536 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280355 WP_000897302.1 NZ_CP124460:2917241-2917552 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|