Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 109567..109806 | Replicon | plasmid pAVS0193-A |
| Accession | NZ_CP124456 | ||
| Organism | Escherichia coli strain AVS0193 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJP76_RS26045 | Protein ID | WP_023144756.1 |
| Coordinates | 109672..109806 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 109567..109627 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP76_RS26015 (105358) | 105358..105918 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| QJP76_RS26020 (106049) | 106049..106261 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| QJP76_RS26025 (106820) | 106820..107245 | + | 426 | WP_000422741.1 | transposase | - |
| QJP76_RS26030 (107242) | 107242..107592 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP76_RS26035 (107623) | 107623..109236 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJP76_RS26040 (109314) | 109314..109600 | + | 287 | Protein_128 | DUF2726 domain-containing protein | - |
| - (109567) | 109567..109627 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (109567) | 109567..109627 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (109567) | 109567..109627 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (109567) | 109567..109627 | - | 61 | NuclAT_2 | - | Antitoxin |
| QJP76_RS26045 (109672) | 109672..109806 | + | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| QJP76_RS26050 (110103) | 110103..110357 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJP76_RS26055 (110594) | 110594..110668 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJP76_RS26060 (110661) | 110661..111518 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJP76_RS26065 (112458) | 112458..113111 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJP76_RS26070 (113204) | 113204..113461 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJP76_RS26075 (113394) | 113394..113795 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..146449 | 146449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280338 WP_023144756.1 NZ_CP124456:109672-109806 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280338 NZ_CP124456:c109627-109567 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
