Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2085191..2085412 Replicon chromosome
Accession NZ_CP124455
Organism Escherichia coli strain AVS0193

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP76_RS10305 Protein ID WP_001531632.1
Coordinates 2085191..2085298 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2085346..2085412 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP76_RS10280 (2081035) 2081035..2082117 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP76_RS10285 (2082117) 2082117..2082950 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP76_RS10290 (2082947) 2082947..2083339 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP76_RS10295 (2083343) 2083343..2084152 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP76_RS10300 (2084188) 2084188..2085042 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP76_RS10305 (2085191) 2085191..2085298 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2085348) 2085348..2085411 + 64 NuclAT_12 - -
- (2085348) 2085348..2085411 + 64 NuclAT_12 - -
- (2085348) 2085348..2085411 + 64 NuclAT_12 - -
- (2085348) 2085348..2085411 + 64 NuclAT_12 - -
- (2085348) 2085348..2085411 + 64 NuclAT_13 - -
- (2085348) 2085348..2085411 + 64 NuclAT_13 - -
- (2085348) 2085348..2085411 + 64 NuclAT_13 - -
- (2085348) 2085348..2085411 + 64 NuclAT_13 - -
- (2085348) 2085348..2085411 + 64 NuclAT_14 - -
- (2085348) 2085348..2085411 + 64 NuclAT_14 - -
- (2085348) 2085348..2085411 + 64 NuclAT_14 - -
- (2085348) 2085348..2085411 + 64 NuclAT_14 - -
- (2085348) 2085348..2085411 + 64 NuclAT_15 - -
- (2085348) 2085348..2085411 + 64 NuclAT_15 - -
- (2085348) 2085348..2085411 + 64 NuclAT_15 - -
- (2085348) 2085348..2085411 + 64 NuclAT_15 - -
- (2085348) 2085348..2085411 + 64 NuclAT_16 - -
- (2085348) 2085348..2085411 + 64 NuclAT_16 - -
- (2085348) 2085348..2085411 + 64 NuclAT_16 - -
- (2085348) 2085348..2085411 + 64 NuclAT_16 - -
- (2085348) 2085348..2085411 + 64 NuclAT_17 - -
- (2085348) 2085348..2085411 + 64 NuclAT_17 - -
- (2085348) 2085348..2085411 + 64 NuclAT_17 - -
- (2085348) 2085348..2085411 + 64 NuclAT_17 - -
- (2085346) 2085346..2085412 + 67 NuclAT_10 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_10 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_10 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_10 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_5 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_5 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_5 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_5 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_6 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_6 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_6 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_6 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_7 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_7 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_7 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_7 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_8 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_8 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_8 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_8 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_9 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_9 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_9 - Antitoxin
- (2085346) 2085346..2085412 + 67 NuclAT_9 - Antitoxin
- (2085348) 2085348..2085413 + 66 NuclAT_18 - -
- (2085348) 2085348..2085413 + 66 NuclAT_18 - -
- (2085348) 2085348..2085413 + 66 NuclAT_18 - -
- (2085348) 2085348..2085413 + 66 NuclAT_18 - -
- (2085348) 2085348..2085413 + 66 NuclAT_19 - -
- (2085348) 2085348..2085413 + 66 NuclAT_19 - -
- (2085348) 2085348..2085413 + 66 NuclAT_19 - -
- (2085348) 2085348..2085413 + 66 NuclAT_19 - -
- (2085348) 2085348..2085413 + 66 NuclAT_20 - -
- (2085348) 2085348..2085413 + 66 NuclAT_20 - -
- (2085348) 2085348..2085413 + 66 NuclAT_20 - -
- (2085348) 2085348..2085413 + 66 NuclAT_20 - -
- (2085348) 2085348..2085413 + 66 NuclAT_21 - -
- (2085348) 2085348..2085413 + 66 NuclAT_21 - -
- (2085348) 2085348..2085413 + 66 NuclAT_21 - -
- (2085348) 2085348..2085413 + 66 NuclAT_21 - -
- (2085348) 2085348..2085413 + 66 NuclAT_22 - -
- (2085348) 2085348..2085413 + 66 NuclAT_22 - -
- (2085348) 2085348..2085413 + 66 NuclAT_22 - -
- (2085348) 2085348..2085413 + 66 NuclAT_22 - -
- (2085348) 2085348..2085413 + 66 NuclAT_23 - -
- (2085348) 2085348..2085413 + 66 NuclAT_23 - -
- (2085348) 2085348..2085413 + 66 NuclAT_23 - -
- (2085348) 2085348..2085413 + 66 NuclAT_23 - -
QJP76_RS10310 (2085703) 2085703..2086803 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP76_RS10315 (2087073) 2087073..2087312 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP76_RS10320 (2087461) 2087461..2088156 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP76_RS10325 (2088200) 2088200..2088553 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP76_RS10330 (2088738) 2088738..2090132 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280319 WP_001531632.1 NZ_CP124455:c2085298-2085191 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280319 NZ_CP124455:2085346-2085412 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References