Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 81841..82080 Replicon plasmid pAVS0196-A
Accession NZ_CP124443
Organism Escherichia coli strain AVS0196

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag QJP94_RS25890 Protein ID WP_023144756.1
Coordinates 81946..82080 (+) Length 45 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 81841..81901 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP94_RS25860 (77632) 77632..78192 + 561 WP_000139341.1 fertility inhibition protein FinO -
QJP94_RS25865 (78323) 78323..78535 + 213 WP_013023861.1 hypothetical protein -
QJP94_RS25870 (79094) 79094..79519 + 426 WP_000422741.1 transposase -
QJP94_RS25875 (79516) 79516..79866 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
QJP94_RS25880 (79897) 79897..81510 + 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
QJP94_RS25885 (81588) 81588..81874 + 287 Protein_99 DUF2726 domain-containing protein -
- (81841) 81841..81901 - 61 NuclAT_2 - Antitoxin
- (81841) 81841..81901 - 61 NuclAT_2 - Antitoxin
- (81841) 81841..81901 - 61 NuclAT_2 - Antitoxin
- (81841) 81841..81901 - 61 NuclAT_2 - Antitoxin
QJP94_RS25890 (81946) 81946..82080 + 135 WP_023144756.1 Hok/Gef family protein Toxin
QJP94_RS25895 (82377) 82377..82631 + 255 WP_000083850.1 replication regulatory protein RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 - 1..82934 82934


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T280311 WP_023144756.1 NZ_CP124443:81946-82080 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT280311 NZ_CP124443:c81901-81841 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References