Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 14067..14309 | Replicon | plasmid pAVS0196-A |
Accession | NZ_CP124443 | ||
Organism | Escherichia coli strain AVS0196 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | QJP94_RS25505 | Protein ID | WP_001372321.1 |
Coordinates | 14067..14192 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 14269..14309 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP94_RS25465 (9494) | 9494..10171 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
QJP94_RS25470 (10305) | 10305..10688 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
QJP94_RS25475 (11031) | 11031..11621 | + | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
QJP94_RS25480 (11918) | 11918..12739 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
QJP94_RS25485 (12858) | 12858..13145 | - | 288 | WP_000107535.1 | hypothetical protein | - |
QJP94_RS25490 (13170) | 13170..13376 | - | 207 | WP_000275859.1 | hypothetical protein | - |
QJP94_RS25495 (13446) | 13446..13619 | + | 174 | Protein_21 | hypothetical protein | - |
QJP94_RS25500 (13617) | 13617..13847 | - | 231 | WP_001426396.1 | hypothetical protein | - |
QJP94_RS25505 (14067) | 14067..14192 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
QJP94_RS25510 (14134) | 14134..14283 | - | 150 | Protein_24 | plasmid maintenance protein Mok | - |
- (14269) | 14269..14309 | - | 41 | NuclAT_1 | - | Antitoxin |
- (14269) | 14269..14309 | - | 41 | NuclAT_1 | - | Antitoxin |
- (14269) | 14269..14309 | - | 41 | NuclAT_1 | - | Antitoxin |
- (14269) | 14269..14309 | - | 41 | NuclAT_1 | - | Antitoxin |
- (15753) | 15753..15939 | - | 187 | NuclAT_0 | - | - |
- (15753) | 15753..15939 | - | 187 | NuclAT_0 | - | - |
- (15753) | 15753..15939 | - | 187 | NuclAT_0 | - | - |
- (15753) | 15753..15939 | - | 187 | NuclAT_0 | - | - |
QJP94_RS25520 (15908) | 15908..16670 | - | 763 | Protein_26 | plasmid SOS inhibition protein A | - |
QJP94_RS25525 (16667) | 16667..17101 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
QJP94_RS25530 (17156) | 17156..19114 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | - | 1..82934 | 82934 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T280306 WP_001372321.1 NZ_CP124443:c14192-14067 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT280306 NZ_CP124443:c14309-14269 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|