Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 5054866..5055087 Replicon chromosome
Accession NZ_CP124442
Organism Escherichia coli strain AVS0196

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP94_RS24940 Protein ID WP_001531632.1
Coordinates 5054866..5054973 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 5055021..5055087 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP94_RS24915 (5050710) 5050710..5051792 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP94_RS24920 (5051792) 5051792..5052625 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP94_RS24925 (5052622) 5052622..5053014 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP94_RS24930 (5053018) 5053018..5053827 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP94_RS24935 (5053863) 5053863..5054717 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP94_RS24940 (5054866) 5054866..5054973 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5055023) 5055023..5055086 + 64 NuclAT_13 - -
- (5055023) 5055023..5055086 + 64 NuclAT_13 - -
- (5055023) 5055023..5055086 + 64 NuclAT_13 - -
- (5055023) 5055023..5055086 + 64 NuclAT_13 - -
- (5055023) 5055023..5055086 + 64 NuclAT_14 - -
- (5055023) 5055023..5055086 + 64 NuclAT_14 - -
- (5055023) 5055023..5055086 + 64 NuclAT_14 - -
- (5055023) 5055023..5055086 + 64 NuclAT_14 - -
- (5055023) 5055023..5055086 + 64 NuclAT_15 - -
- (5055023) 5055023..5055086 + 64 NuclAT_15 - -
- (5055023) 5055023..5055086 + 64 NuclAT_15 - -
- (5055023) 5055023..5055086 + 64 NuclAT_15 - -
- (5055023) 5055023..5055086 + 64 NuclAT_16 - -
- (5055023) 5055023..5055086 + 64 NuclAT_16 - -
- (5055023) 5055023..5055086 + 64 NuclAT_16 - -
- (5055023) 5055023..5055086 + 64 NuclAT_16 - -
- (5055023) 5055023..5055086 + 64 NuclAT_17 - -
- (5055023) 5055023..5055086 + 64 NuclAT_17 - -
- (5055023) 5055023..5055086 + 64 NuclAT_17 - -
- (5055023) 5055023..5055086 + 64 NuclAT_17 - -
- (5055023) 5055023..5055086 + 64 NuclAT_18 - -
- (5055023) 5055023..5055086 + 64 NuclAT_18 - -
- (5055023) 5055023..5055086 + 64 NuclAT_18 - -
- (5055023) 5055023..5055086 + 64 NuclAT_18 - -
- (5055021) 5055021..5055087 + 67 NuclAT_10 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_10 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_10 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_10 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_11 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_11 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_11 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_11 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_6 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_6 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_6 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_6 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_7 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_7 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_7 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_7 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_8 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_8 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_8 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_8 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_9 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_9 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_9 - Antitoxin
- (5055021) 5055021..5055087 + 67 NuclAT_9 - Antitoxin
- (5055023) 5055023..5055088 + 66 NuclAT_19 - -
- (5055023) 5055023..5055088 + 66 NuclAT_19 - -
- (5055023) 5055023..5055088 + 66 NuclAT_19 - -
- (5055023) 5055023..5055088 + 66 NuclAT_19 - -
- (5055023) 5055023..5055088 + 66 NuclAT_20 - -
- (5055023) 5055023..5055088 + 66 NuclAT_20 - -
- (5055023) 5055023..5055088 + 66 NuclAT_20 - -
- (5055023) 5055023..5055088 + 66 NuclAT_20 - -
- (5055023) 5055023..5055088 + 66 NuclAT_21 - -
- (5055023) 5055023..5055088 + 66 NuclAT_21 - -
- (5055023) 5055023..5055088 + 66 NuclAT_21 - -
- (5055023) 5055023..5055088 + 66 NuclAT_21 - -
- (5055023) 5055023..5055088 + 66 NuclAT_22 - -
- (5055023) 5055023..5055088 + 66 NuclAT_22 - -
- (5055023) 5055023..5055088 + 66 NuclAT_22 - -
- (5055023) 5055023..5055088 + 66 NuclAT_22 - -
- (5055023) 5055023..5055088 + 66 NuclAT_23 - -
- (5055023) 5055023..5055088 + 66 NuclAT_23 - -
- (5055023) 5055023..5055088 + 66 NuclAT_23 - -
- (5055023) 5055023..5055088 + 66 NuclAT_23 - -
- (5055023) 5055023..5055088 + 66 NuclAT_24 - -
- (5055023) 5055023..5055088 + 66 NuclAT_24 - -
- (5055023) 5055023..5055088 + 66 NuclAT_24 - -
- (5055023) 5055023..5055088 + 66 NuclAT_24 - -
QJP94_RS24945 (5055378) 5055378..5056478 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP94_RS24950 (5056748) 5056748..5056987 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP94_RS24955 (5057136) 5057136..5057831 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP94_RS24960 (5057875) 5057875..5058228 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP94_RS24965 (5058413) 5058413..5059807 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280302 WP_001531632.1 NZ_CP124442:c5054973-5054866 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280302 NZ_CP124442:5055021-5055087 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References