Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3016390..3016992 | Replicon | chromosome |
Accession | NZ_CP124442 | ||
Organism | Escherichia coli strain AVS0196 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QJP94_RS14920 | Protein ID | WP_000897302.1 |
Coordinates | 3016390..3016701 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QJP94_RS14925 | Protein ID | WP_000356397.1 |
Coordinates | 3016702..3016992 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP94_RS14895 (3012304) | 3012304..3012903 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
QJP94_RS14900 (3012897) | 3012897..3013769 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QJP94_RS14905 (3013766) | 3013766..3014203 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
QJP94_RS14910 (3014248) | 3014248..3015189 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QJP94_RS14915 (3015253) | 3015253..3016161 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
QJP94_RS14920 (3016390) | 3016390..3016701 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QJP94_RS14925 (3016702) | 3016702..3016992 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QJP94_RS14930 (3017351) | 3017351..3017629 | + | 279 | WP_001296612.1 | hypothetical protein | - |
QJP94_RS14935 (3018026) | 3018026..3018244 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
QJP94_RS14940 (3018429) | 3018429..3019169 | - | 741 | WP_000608806.1 | hypothetical protein | - |
QJP94_RS14945 (3019194) | 3019194..3020042 | - | 849 | WP_001038650.1 | hypothetical protein | - |
QJP94_RS14950 (3020332) | 3020332..3020574 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
QJP94_RS14955 (3020756) | 3020756..3021685 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280293 WP_000897302.1 NZ_CP124442:3016390-3016701 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|