Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2203691..2204490 | Replicon | chromosome |
Accession | NZ_CP124442 | ||
Organism | Escherichia coli strain AVS0196 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | QJP94_RS10940 | Protein ID | WP_000347251.1 |
Coordinates | 2204026..2204490 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | QJP94_RS10935 | Protein ID | WP_001296435.1 |
Coordinates | 2203691..2204026 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP94_RS10920 (2199476) | 2199476..2200246 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
QJP94_RS10925 (2200262) | 2200262..2201596 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
QJP94_RS10930 (2201971) | 2201971..2203542 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
QJP94_RS10935 (2203691) | 2203691..2204026 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QJP94_RS10940 (2204026) | 2204026..2204490 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QJP94_RS10945 (2204545) | 2204545..2205354 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QJP94_RS10950 (2205603) | 2205603..2206883 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QJP94_RS10955 (2206906) | 2206906..2207379 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QJP94_RS10960 (2207390) | 2207390..2208169 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QJP94_RS10965 (2208159) | 2208159..2209037 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QJP94_RS10970 (2209055) | 2209055..2209489 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T280291 WP_000347251.1 NZ_CP124442:2204026-2204490 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |