Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 5067243..5067464 Replicon chromosome
Accession NZ_CP124436
Organism Escherichia coli strain AVS0790

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP66_RS24970 Protein ID WP_001531632.1
Coordinates 5067243..5067350 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 5067398..5067464 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP66_RS24945 (5063087) 5063087..5064169 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP66_RS24950 (5064169) 5064169..5065002 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP66_RS24955 (5064999) 5064999..5065391 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP66_RS24960 (5065395) 5065395..5066204 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP66_RS24965 (5066240) 5066240..5067094 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP66_RS24970 (5067243) 5067243..5067350 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5067400) 5067400..5067463 + 64 NuclAT_13 - -
- (5067400) 5067400..5067463 + 64 NuclAT_13 - -
- (5067400) 5067400..5067463 + 64 NuclAT_13 - -
- (5067400) 5067400..5067463 + 64 NuclAT_13 - -
- (5067400) 5067400..5067463 + 64 NuclAT_14 - -
- (5067400) 5067400..5067463 + 64 NuclAT_14 - -
- (5067400) 5067400..5067463 + 64 NuclAT_14 - -
- (5067400) 5067400..5067463 + 64 NuclAT_14 - -
- (5067400) 5067400..5067463 + 64 NuclAT_15 - -
- (5067400) 5067400..5067463 + 64 NuclAT_15 - -
- (5067400) 5067400..5067463 + 64 NuclAT_15 - -
- (5067400) 5067400..5067463 + 64 NuclAT_15 - -
- (5067400) 5067400..5067463 + 64 NuclAT_16 - -
- (5067400) 5067400..5067463 + 64 NuclAT_16 - -
- (5067400) 5067400..5067463 + 64 NuclAT_16 - -
- (5067400) 5067400..5067463 + 64 NuclAT_16 - -
- (5067400) 5067400..5067463 + 64 NuclAT_17 - -
- (5067400) 5067400..5067463 + 64 NuclAT_17 - -
- (5067400) 5067400..5067463 + 64 NuclAT_17 - -
- (5067400) 5067400..5067463 + 64 NuclAT_17 - -
- (5067400) 5067400..5067463 + 64 NuclAT_18 - -
- (5067400) 5067400..5067463 + 64 NuclAT_18 - -
- (5067400) 5067400..5067463 + 64 NuclAT_18 - -
- (5067400) 5067400..5067463 + 64 NuclAT_18 - -
- (5067398) 5067398..5067464 + 67 NuclAT_10 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_10 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_10 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_10 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_11 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_11 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_11 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_11 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_6 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_6 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_6 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_6 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_7 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_7 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_7 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_7 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_8 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_8 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_8 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_8 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_9 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_9 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_9 - Antitoxin
- (5067398) 5067398..5067464 + 67 NuclAT_9 - Antitoxin
- (5067400) 5067400..5067465 + 66 NuclAT_19 - -
- (5067400) 5067400..5067465 + 66 NuclAT_19 - -
- (5067400) 5067400..5067465 + 66 NuclAT_19 - -
- (5067400) 5067400..5067465 + 66 NuclAT_19 - -
- (5067400) 5067400..5067465 + 66 NuclAT_20 - -
- (5067400) 5067400..5067465 + 66 NuclAT_20 - -
- (5067400) 5067400..5067465 + 66 NuclAT_20 - -
- (5067400) 5067400..5067465 + 66 NuclAT_20 - -
- (5067400) 5067400..5067465 + 66 NuclAT_21 - -
- (5067400) 5067400..5067465 + 66 NuclAT_21 - -
- (5067400) 5067400..5067465 + 66 NuclAT_21 - -
- (5067400) 5067400..5067465 + 66 NuclAT_21 - -
- (5067400) 5067400..5067465 + 66 NuclAT_22 - -
- (5067400) 5067400..5067465 + 66 NuclAT_22 - -
- (5067400) 5067400..5067465 + 66 NuclAT_22 - -
- (5067400) 5067400..5067465 + 66 NuclAT_22 - -
- (5067400) 5067400..5067465 + 66 NuclAT_23 - -
- (5067400) 5067400..5067465 + 66 NuclAT_23 - -
- (5067400) 5067400..5067465 + 66 NuclAT_23 - -
- (5067400) 5067400..5067465 + 66 NuclAT_23 - -
- (5067400) 5067400..5067465 + 66 NuclAT_24 - -
- (5067400) 5067400..5067465 + 66 NuclAT_24 - -
- (5067400) 5067400..5067465 + 66 NuclAT_24 - -
- (5067400) 5067400..5067465 + 66 NuclAT_24 - -
QJP66_RS24975 (5067755) 5067755..5068855 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP66_RS24980 (5069125) 5069125..5069364 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP66_RS24985 (5069513) 5069513..5070208 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP66_RS24990 (5070252) 5070252..5070605 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP66_RS24995 (5070790) 5070790..5072184 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280271 WP_001531632.1 NZ_CP124436:c5067350-5067243 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280271 NZ_CP124436:5067398-5067464 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References