Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3015110..3015712 | Replicon | chromosome |
| Accession | NZ_CP124436 | ||
| Organism | Escherichia coli strain AVS0790 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP66_RS14905 | Protein ID | WP_000897302.1 |
| Coordinates | 3015110..3015421 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP66_RS14910 | Protein ID | WP_000356397.1 |
| Coordinates | 3015422..3015712 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP66_RS14880 (3011024) | 3011024..3011623 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QJP66_RS14885 (3011617) | 3011617..3012489 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJP66_RS14890 (3012486) | 3012486..3012923 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP66_RS14895 (3012968) | 3012968..3013909 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP66_RS14900 (3013973) | 3013973..3014881 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP66_RS14905 (3015110) | 3015110..3015421 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP66_RS14910 (3015422) | 3015422..3015712 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP66_RS14915 (3016071) | 3016071..3016349 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP66_RS14920 (3016746) | 3016746..3016964 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP66_RS14925 (3017149) | 3017149..3017889 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP66_RS14930 (3017914) | 3017914..3018762 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP66_RS14935 (3019052) | 3019052..3019294 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP66_RS14940 (3019476) | 3019476..3020405 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280262 WP_000897302.1 NZ_CP124436:3015110-3015421 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|