Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 42173..42437 | Replicon | plasmid pAVS0051-B |
Accession | NZ_CP124431 | ||
Organism | Escherichia coli strain AVS0051 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | QJP74_RS25180 | Protein ID | WP_001331364.1 |
Coordinates | 42285..42437 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 42173..42230 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP74_RS25165 (37412) | 37412..39703 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
QJP74_RS25170 (39696) | 39696..40766 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
QJP74_RS25175 (40785) | 40785..41993 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- (42173) | 42173..42230 | - | 58 | NuclAT_0 | - | Antitoxin |
- (42173) | 42173..42230 | - | 58 | NuclAT_0 | - | Antitoxin |
- (42173) | 42173..42230 | - | 58 | NuclAT_0 | - | Antitoxin |
- (42173) | 42173..42230 | - | 58 | NuclAT_0 | - | Antitoxin |
QJP74_RS25180 (42285) | 42285..42437 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
QJP74_RS25185 (42509) | 42509..42760 | - | 252 | WP_001291964.1 | hypothetical protein | - |
QJP74_RS25190 (43259) | 43259..43354 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
QJP74_RS25195 (43419) | 43419..43595 | - | 177 | WP_001054897.1 | hypothetical protein | - |
QJP74_RS25200 (43987) | 43987..44196 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
QJP74_RS25205 (44268) | 44268..44918 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
QJP74_RS25210 (44992) | 44992..47160 | - | 2169 | WP_001774191.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..87732 | 87732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T280246 WP_001331364.1 NZ_CP124431:42285-42437 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT280246 NZ_CP124431:c42230-42173 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|