Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 42173..42437 Replicon plasmid pAVS0051-B
Accession NZ_CP124431
Organism Escherichia coli strain AVS0051

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag QJP74_RS25180 Protein ID WP_001331364.1
Coordinates 42285..42437 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 42173..42230 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP74_RS25165 (37412) 37412..39703 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
QJP74_RS25170 (39696) 39696..40766 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
QJP74_RS25175 (40785) 40785..41993 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (42173) 42173..42230 - 58 NuclAT_0 - Antitoxin
- (42173) 42173..42230 - 58 NuclAT_0 - Antitoxin
- (42173) 42173..42230 - 58 NuclAT_0 - Antitoxin
- (42173) 42173..42230 - 58 NuclAT_0 - Antitoxin
QJP74_RS25180 (42285) 42285..42437 + 153 WP_001331364.1 Hok/Gef family protein Toxin
QJP74_RS25185 (42509) 42509..42760 - 252 WP_001291964.1 hypothetical protein -
QJP74_RS25190 (43259) 43259..43354 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QJP74_RS25195 (43419) 43419..43595 - 177 WP_001054897.1 hypothetical protein -
QJP74_RS25200 (43987) 43987..44196 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QJP74_RS25205 (44268) 44268..44918 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
QJP74_RS25210 (44992) 44992..47160 - 2169 WP_001774191.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..87732 87732


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T280246 WP_001331364.1 NZ_CP124431:42285-42437 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT280246 NZ_CP124431:c42230-42173 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References