Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 77189..77431 | Replicon | plasmid pAVS0051-A |
| Accession | NZ_CP124430 | ||
| Organism | Escherichia coli strain AVS0051 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP74_RS24715 | Protein ID | WP_001372321.1 |
| Coordinates | 77189..77314 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 77391..77431 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP74_RS24670 (72301) | 72301..72528 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| QJP74_RS24675 (72616) | 72616..73293 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| QJP74_RS24680 (73427) | 73427..73810 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP74_RS24685 (74153) | 74153..74743 | + | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
| QJP74_RS24690 (75040) | 75040..75861 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| QJP74_RS24695 (75980) | 75980..76267 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJP74_RS24700 (76292) | 76292..76498 | - | 207 | WP_024217497.1 | hypothetical protein | - |
| QJP74_RS24705 (76568) | 76568..76741 | + | 174 | Protein_86 | hypothetical protein | - |
| QJP74_RS24710 (76739) | 76739..76969 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| QJP74_RS24715 (77189) | 77189..77314 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP74_RS24720 (77256) | 77256..77405 | - | 150 | Protein_89 | plasmid maintenance protein Mok | - |
| - (77391) | 77391..77431 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (77391) | 77391..77431 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (77391) | 77391..77431 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (77391) | 77391..77431 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (78875) | 78875..79061 | - | 187 | NuclAT_0 | - | - |
| - (78875) | 78875..79061 | - | 187 | NuclAT_0 | - | - |
| - (78875) | 78875..79061 | - | 187 | NuclAT_0 | - | - |
| - (78875) | 78875..79061 | - | 187 | NuclAT_0 | - | - |
| QJP74_RS24730 (79030) | 79030..79792 | - | 763 | Protein_91 | plasmid SOS inhibition protein A | - |
| QJP74_RS24735 (79789) | 79789..80223 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| QJP74_RS24740 (80276) | 80276..82231 | - | 1956 | Protein_93 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 | senB | 1..113044 | 113044 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T280241 WP_001372321.1 NZ_CP124430:c77314-77189 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT280241 NZ_CP124430:c77431-77391 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|