Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 49704..49943 | Replicon | plasmid pAVS0051-A |
| Accession | NZ_CP124430 | ||
| Organism | Escherichia coli strain AVS0051 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJP74_RS24555 | Protein ID | WP_023144756.1 |
| Coordinates | 49704..49838 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 49883..49943 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP74_RS24520 (45051) | 45051..45466 | - | 416 | Protein_49 | IS1-like element IS1B family transposase | - |
| QJP74_RS24525 (45715) | 45715..46116 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJP74_RS24530 (46049) | 46049..46306 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJP74_RS24535 (46399) | 46399..47052 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJP74_RS24540 (47992) | 47992..48849 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJP74_RS24545 (48842) | 48842..48916 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJP74_RS24550 (49153) | 49153..49407 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJP74_RS24555 (49704) | 49704..49838 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (49883) | 49883..49943 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (49883) | 49883..49943 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (49883) | 49883..49943 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (49883) | 49883..49943 | + | 61 | NuclAT_2 | - | Antitoxin |
| QJP74_RS24560 (49910) | 49910..50196 | - | 287 | Protein_57 | DUF2726 domain-containing protein | - |
| QJP74_RS24565 (50274) | 50274..51887 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJP74_RS24570 (51918) | 51918..52268 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP74_RS24575 (52265) | 52265..52690 | - | 426 | WP_000422741.1 | transposase | - |
| QJP74_RS24580 (53249) | 53249..53461 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QJP74_RS24585 (53592) | 53592..54152 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 | senB | 1..113044 | 113044 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280237 WP_023144756.1 NZ_CP124430:c49838-49704 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280237 NZ_CP124430:49883-49943 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|