Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4089900..4090627 | Replicon | chromosome |
Accession | NZ_CP124429 | ||
Organism | Escherichia coli strain AVS0051 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | QJP74_RS19900 | Protein ID | WP_000550189.1 |
Coordinates | 4090313..4090627 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QJP74_RS19895 | Protein ID | WP_000560269.1 |
Coordinates | 4089900..4090316 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP74_RS19885 (4085260) | 4085260..4087611 | + | 2352 | WP_000695432.1 | alpha-glucosidase | - |
QJP74_RS19890 (4087837) | 4087837..4089855 | + | 2019 | WP_000121413.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
QJP74_RS19895 (4089900) | 4089900..4090316 | - | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
QJP74_RS19900 (4090313) | 4090313..4090627 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
QJP74_RS19905 (4090912) | 4090912..4092048 | - | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
QJP74_RS19910 (4092133) | 4092133..4092636 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
QJP74_RS19915 (4092713) | 4092713..4093405 | + | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
QJP74_RS19920 (4093484) | 4093484..4094470 | + | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T280233 WP_000550189.1 NZ_CP124429:c4090627-4090313 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT280233 WP_000560269.1 NZ_CP124429:c4090316-4089900 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|