Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1979908..1980129 Replicon chromosome
Accession NZ_CP124429
Organism Escherichia coli strain AVS0051

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP74_RS09665 Protein ID WP_001531632.1
Coordinates 1979908..1980015 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1980063..1980129 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP74_RS09640 (1975752) 1975752..1976834 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP74_RS09645 (1976834) 1976834..1977667 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP74_RS09650 (1977664) 1977664..1978056 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP74_RS09655 (1978060) 1978060..1978869 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP74_RS09660 (1978905) 1978905..1979759 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP74_RS09665 (1979908) 1979908..1980015 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1980065) 1980065..1980128 + 64 NuclAT_12 - -
- (1980065) 1980065..1980128 + 64 NuclAT_12 - -
- (1980065) 1980065..1980128 + 64 NuclAT_12 - -
- (1980065) 1980065..1980128 + 64 NuclAT_12 - -
- (1980065) 1980065..1980128 + 64 NuclAT_13 - -
- (1980065) 1980065..1980128 + 64 NuclAT_13 - -
- (1980065) 1980065..1980128 + 64 NuclAT_13 - -
- (1980065) 1980065..1980128 + 64 NuclAT_13 - -
- (1980065) 1980065..1980128 + 64 NuclAT_14 - -
- (1980065) 1980065..1980128 + 64 NuclAT_14 - -
- (1980065) 1980065..1980128 + 64 NuclAT_14 - -
- (1980065) 1980065..1980128 + 64 NuclAT_14 - -
- (1980065) 1980065..1980128 + 64 NuclAT_15 - -
- (1980065) 1980065..1980128 + 64 NuclAT_15 - -
- (1980065) 1980065..1980128 + 64 NuclAT_15 - -
- (1980065) 1980065..1980128 + 64 NuclAT_15 - -
- (1980065) 1980065..1980128 + 64 NuclAT_16 - -
- (1980065) 1980065..1980128 + 64 NuclAT_16 - -
- (1980065) 1980065..1980128 + 64 NuclAT_16 - -
- (1980065) 1980065..1980128 + 64 NuclAT_16 - -
- (1980065) 1980065..1980128 + 64 NuclAT_17 - -
- (1980065) 1980065..1980128 + 64 NuclAT_17 - -
- (1980065) 1980065..1980128 + 64 NuclAT_17 - -
- (1980065) 1980065..1980128 + 64 NuclAT_17 - -
- (1980063) 1980063..1980129 + 67 NuclAT_10 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_10 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_10 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_10 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_5 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_5 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_5 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_5 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_6 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_6 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_6 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_6 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_7 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_7 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_7 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_7 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_8 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_8 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_8 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_8 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_9 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_9 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_9 - Antitoxin
- (1980063) 1980063..1980129 + 67 NuclAT_9 - Antitoxin
- (1980065) 1980065..1980130 + 66 NuclAT_18 - -
- (1980065) 1980065..1980130 + 66 NuclAT_18 - -
- (1980065) 1980065..1980130 + 66 NuclAT_18 - -
- (1980065) 1980065..1980130 + 66 NuclAT_18 - -
- (1980065) 1980065..1980130 + 66 NuclAT_19 - -
- (1980065) 1980065..1980130 + 66 NuclAT_19 - -
- (1980065) 1980065..1980130 + 66 NuclAT_19 - -
- (1980065) 1980065..1980130 + 66 NuclAT_19 - -
- (1980065) 1980065..1980130 + 66 NuclAT_20 - -
- (1980065) 1980065..1980130 + 66 NuclAT_20 - -
- (1980065) 1980065..1980130 + 66 NuclAT_20 - -
- (1980065) 1980065..1980130 + 66 NuclAT_20 - -
- (1980065) 1980065..1980130 + 66 NuclAT_21 - -
- (1980065) 1980065..1980130 + 66 NuclAT_21 - -
- (1980065) 1980065..1980130 + 66 NuclAT_21 - -
- (1980065) 1980065..1980130 + 66 NuclAT_21 - -
- (1980065) 1980065..1980130 + 66 NuclAT_22 - -
- (1980065) 1980065..1980130 + 66 NuclAT_22 - -
- (1980065) 1980065..1980130 + 66 NuclAT_22 - -
- (1980065) 1980065..1980130 + 66 NuclAT_22 - -
- (1980065) 1980065..1980130 + 66 NuclAT_23 - -
- (1980065) 1980065..1980130 + 66 NuclAT_23 - -
- (1980065) 1980065..1980130 + 66 NuclAT_23 - -
- (1980065) 1980065..1980130 + 66 NuclAT_23 - -
QJP74_RS09670 (1980420) 1980420..1981520 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP74_RS09675 (1981790) 1981790..1982029 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP74_RS09680 (1982178) 1982178..1982873 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP74_RS09685 (1982917) 1982917..1983270 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP74_RS09690 (1983455) 1983455..1984849 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280220 WP_001531632.1 NZ_CP124429:c1980015-1979908 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280220 NZ_CP124429:1980063-1980129 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References