Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 68797..69039 | Replicon | plasmid pAVS0247-A |
| Accession | NZ_CP124425 | ||
| Organism | Escherichia coli strain AVS0247 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJB03_RS24730 | Protein ID | WP_001372321.1 |
| Coordinates | 68797..68922 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 68999..69039 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB03_RS24685 (63909) | 63909..64136 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| QJB03_RS24690 (64224) | 64224..64901 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| QJB03_RS24695 (65035) | 65035..65418 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJB03_RS24700 (65761) | 65761..66351 | + | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
| QJB03_RS24705 (66648) | 66648..67469 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| QJB03_RS24710 (67588) | 67588..67875 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJB03_RS24715 (67900) | 67900..68106 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| QJB03_RS24720 (68176) | 68176..68349 | + | 174 | Protein_85 | hypothetical protein | - |
| QJB03_RS24725 (68347) | 68347..68577 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| QJB03_RS24730 (68797) | 68797..68922 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJB03_RS24735 (68864) | 68864..69013 | - | 150 | Protein_88 | plasmid maintenance protein Mok | - |
| - (68999) | 68999..69039 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (68999) | 68999..69039 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (68999) | 68999..69039 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (68999) | 68999..69039 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (70483) | 70483..70669 | - | 187 | NuclAT_0 | - | - |
| - (70483) | 70483..70669 | - | 187 | NuclAT_0 | - | - |
| - (70483) | 70483..70669 | - | 187 | NuclAT_0 | - | - |
| - (70483) | 70483..70669 | - | 187 | NuclAT_0 | - | - |
| QJB03_RS24745 (70638) | 70638..71400 | - | 763 | Protein_90 | plasmid SOS inhibition protein A | - |
| QJB03_RS24750 (71397) | 71397..71831 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| QJB03_RS24755 (71886) | 71886..73844 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..104594 | 104594 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T280207 WP_001372321.1 NZ_CP124425:c68922-68797 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT280207 NZ_CP124425:c69039-68999 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
