Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59210..59449 | Replicon | plasmid pAVS0247-A |
| Accession | NZ_CP124425 | ||
| Organism | Escherichia coli strain AVS0247 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJB03_RS24645 | Protein ID | WP_023144756.1 |
| Coordinates | 59210..59344 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 59389..59449 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB03_RS24610 (54557) | 54557..54972 | - | 416 | Protein_63 | IS1-like element IS1B family transposase | - |
| QJB03_RS24615 (55221) | 55221..55622 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJB03_RS24620 (55555) | 55555..55812 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJB03_RS24625 (55905) | 55905..56558 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJB03_RS24630 (57498) | 57498..58355 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJB03_RS24635 (58348) | 58348..58422 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJB03_RS24640 (58659) | 58659..58913 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJB03_RS24645 (59210) | 59210..59344 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (59389) | 59389..59449 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (59389) | 59389..59449 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (59389) | 59389..59449 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (59389) | 59389..59449 | + | 61 | NuclAT_2 | - | Antitoxin |
| QJB03_RS24650 (59416) | 59416..59702 | - | 287 | Protein_71 | DUF2726 domain-containing protein | - |
| QJB03_RS24655 (59780) | 59780..61393 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJB03_RS24660 (61424) | 61424..61774 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJB03_RS24665 (61771) | 61771..62196 | - | 426 | WP_000422741.1 | transposase | - |
| QJB03_RS24675 (63197) | 63197..63508 | - | 312 | WP_000012107.1 | type IV conjugative transfer system protein TraL | - |
| QJB03_RS24680 (63513) | 63513..63875 | - | 363 | WP_000338606.1 | type IV conjugative transfer system pilin TraA | - |
| QJB03_RS24685 (63909) | 63909..64136 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..104594 | 104594 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280203 WP_023144756.1 NZ_CP124425:c59344-59210 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280203 NZ_CP124425:59389-59449 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|