Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2853805..2854407 | Replicon | chromosome |
| Accession | NZ_CP124424 | ||
| Organism | Escherichia coli strain AVS0247 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJB03_RS13830 | Protein ID | WP_000897302.1 |
| Coordinates | 2853805..2854116 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJB03_RS13835 | Protein ID | WP_000356397.1 |
| Coordinates | 2854117..2854407 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB03_RS13805 (2849719) | 2849719..2850318 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QJB03_RS13810 (2850312) | 2850312..2851184 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJB03_RS13815 (2851181) | 2851181..2851618 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJB03_RS13820 (2851663) | 2851663..2852604 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJB03_RS13825 (2852668) | 2852668..2853576 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJB03_RS13830 (2853805) | 2853805..2854116 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJB03_RS13835 (2854117) | 2854117..2854407 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJB03_RS13840 (2854766) | 2854766..2855044 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJB03_RS13845 (2855441) | 2855441..2855659 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJB03_RS13850 (2855844) | 2855844..2856584 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJB03_RS13855 (2856609) | 2856609..2857457 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJB03_RS13860 (2857747) | 2857747..2857989 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJB03_RS13865 (2858171) | 2858171..2859100 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280190 WP_000897302.1 NZ_CP124424:2853805-2854116 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|