Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3387813..3388415 | Replicon | chromosome |
| Accession | NZ_CP124420 | ||
| Organism | Escherichia coli strain AVS0155 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP63_RS16715 | Protein ID | WP_000897302.1 |
| Coordinates | 3387813..3388124 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP63_RS16720 | Protein ID | WP_000356397.1 |
| Coordinates | 3388125..3388415 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP63_RS16690 (3383727) | 3383727..3384326 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QJP63_RS16695 (3384320) | 3384320..3385192 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJP63_RS16700 (3385189) | 3385189..3385626 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP63_RS16705 (3385671) | 3385671..3386612 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP63_RS16710 (3386676) | 3386676..3387584 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP63_RS16715 (3387813) | 3387813..3388124 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP63_RS16720 (3388125) | 3388125..3388415 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP63_RS16725 (3388774) | 3388774..3389052 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP63_RS16730 (3389449) | 3389449..3389667 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP63_RS16735 (3389852) | 3389852..3390592 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP63_RS16740 (3390617) | 3390617..3391465 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP63_RS16745 (3391755) | 3391755..3391997 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP63_RS16750 (3392179) | 3392179..3393108 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280163 WP_000897302.1 NZ_CP124420:3387813-3388124 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|