Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 93881..94123 | Replicon | plasmid pAVS0223-A |
| Accession | NZ_CP124416 | ||
| Organism | Escherichia coli strain AVS0223 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP60_RS24720 | Protein ID | WP_001372321.1 |
| Coordinates | 93881..94006 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 94083..94123 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP60_RS24675 (88993) | 88993..89220 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| QJP60_RS24680 (89308) | 89308..89985 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| QJP60_RS24685 (90119) | 90119..90502 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP60_RS24690 (90845) | 90845..91435 | + | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
| QJP60_RS24695 (91732) | 91732..92553 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| QJP60_RS24700 (92672) | 92672..92959 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJP60_RS24705 (92984) | 92984..93190 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| QJP60_RS24710 (93260) | 93260..93433 | + | 174 | Protein_111 | hypothetical protein | - |
| QJP60_RS24715 (93431) | 93431..93661 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| QJP60_RS24720 (93881) | 93881..94006 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP60_RS24725 (93948) | 93948..94097 | - | 150 | Protein_114 | plasmid maintenance protein Mok | - |
| - (94083) | 94083..94123 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (94083) | 94083..94123 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (94083) | 94083..94123 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (94083) | 94083..94123 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (95567) | 95567..95753 | - | 187 | NuclAT_0 | - | - |
| - (95567) | 95567..95753 | - | 187 | NuclAT_0 | - | - |
| - (95567) | 95567..95753 | - | 187 | NuclAT_0 | - | - |
| - (95567) | 95567..95753 | - | 187 | NuclAT_0 | - | - |
| QJP60_RS24735 (95722) | 95722..96484 | - | 763 | Protein_116 | plasmid SOS inhibition protein A | - |
| QJP60_RS24740 (96481) | 96481..96915 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| QJP60_RS24745 (96970) | 96970..98928 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..134299 | 134299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T280141 WP_001372321.1 NZ_CP124416:c94006-93881 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT280141 NZ_CP124416:c94123-94083 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|