Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 66414..66653 | Replicon | plasmid pAVS0223-A |
| Accession | NZ_CP124416 | ||
| Organism | Escherichia coli strain AVS0223 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJP60_RS24560 | Protein ID | WP_023144756.1 |
| Coordinates | 66414..66548 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 66593..66653 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP60_RS24525 (61762) | 61762..62176 | - | 415 | Protein_74 | IS1-like element IS1B family transposase | - |
| QJP60_RS24530 (62425) | 62425..62826 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJP60_RS24535 (62759) | 62759..63016 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJP60_RS24540 (63109) | 63109..63762 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJP60_RS24545 (64702) | 64702..65559 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJP60_RS24550 (65552) | 65552..65626 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJP60_RS24555 (65863) | 65863..66117 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJP60_RS24560 (66414) | 66414..66548 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (66593) | 66593..66653 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (66593) | 66593..66653 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (66593) | 66593..66653 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (66593) | 66593..66653 | + | 61 | NuclAT_2 | - | Antitoxin |
| QJP60_RS24565 (66620) | 66620..66906 | - | 287 | Protein_82 | DUF2726 domain-containing protein | - |
| QJP60_RS24570 (66984) | 66984..68597 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJP60_RS24575 (68628) | 68628..68978 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP60_RS24580 (68975) | 68975..69400 | - | 426 | WP_000422741.1 | transposase | - |
| QJP60_RS24585 (69959) | 69959..70171 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QJP60_RS24590 (70302) | 70302..70862 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..134299 | 134299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280137 WP_023144756.1 NZ_CP124416:c66548-66414 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280137 NZ_CP124416:66593-66653 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
