Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4892888..4893109 Replicon chromosome
Accession NZ_CP124415
Organism Escherichia coli strain AVS0223

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP60_RS23705 Protein ID WP_001531632.1
Coordinates 4892888..4892995 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4893043..4893109 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP60_RS23680 (4888732) 4888732..4889814 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP60_RS23685 (4889814) 4889814..4890647 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP60_RS23690 (4890644) 4890644..4891036 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP60_RS23695 (4891040) 4891040..4891849 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP60_RS23700 (4891885) 4891885..4892739 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP60_RS23705 (4892888) 4892888..4892995 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4893045) 4893045..4893108 + 64 NuclAT_12 - -
- (4893045) 4893045..4893108 + 64 NuclAT_12 - -
- (4893045) 4893045..4893108 + 64 NuclAT_12 - -
- (4893045) 4893045..4893108 + 64 NuclAT_12 - -
- (4893045) 4893045..4893108 + 64 NuclAT_13 - -
- (4893045) 4893045..4893108 + 64 NuclAT_13 - -
- (4893045) 4893045..4893108 + 64 NuclAT_13 - -
- (4893045) 4893045..4893108 + 64 NuclAT_13 - -
- (4893045) 4893045..4893108 + 64 NuclAT_14 - -
- (4893045) 4893045..4893108 + 64 NuclAT_14 - -
- (4893045) 4893045..4893108 + 64 NuclAT_14 - -
- (4893045) 4893045..4893108 + 64 NuclAT_14 - -
- (4893045) 4893045..4893108 + 64 NuclAT_15 - -
- (4893045) 4893045..4893108 + 64 NuclAT_15 - -
- (4893045) 4893045..4893108 + 64 NuclAT_15 - -
- (4893045) 4893045..4893108 + 64 NuclAT_15 - -
- (4893045) 4893045..4893108 + 64 NuclAT_16 - -
- (4893045) 4893045..4893108 + 64 NuclAT_16 - -
- (4893045) 4893045..4893108 + 64 NuclAT_16 - -
- (4893045) 4893045..4893108 + 64 NuclAT_16 - -
- (4893045) 4893045..4893108 + 64 NuclAT_17 - -
- (4893045) 4893045..4893108 + 64 NuclAT_17 - -
- (4893045) 4893045..4893108 + 64 NuclAT_17 - -
- (4893045) 4893045..4893108 + 64 NuclAT_17 - -
- (4893043) 4893043..4893109 + 67 NuclAT_10 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_10 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_10 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_10 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_5 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_5 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_5 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_5 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_6 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_6 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_6 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_6 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_7 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_7 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_7 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_7 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_8 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_8 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_8 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_8 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_9 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_9 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_9 - Antitoxin
- (4893043) 4893043..4893109 + 67 NuclAT_9 - Antitoxin
- (4893045) 4893045..4893110 + 66 NuclAT_18 - -
- (4893045) 4893045..4893110 + 66 NuclAT_18 - -
- (4893045) 4893045..4893110 + 66 NuclAT_18 - -
- (4893045) 4893045..4893110 + 66 NuclAT_18 - -
- (4893045) 4893045..4893110 + 66 NuclAT_19 - -
- (4893045) 4893045..4893110 + 66 NuclAT_19 - -
- (4893045) 4893045..4893110 + 66 NuclAT_19 - -
- (4893045) 4893045..4893110 + 66 NuclAT_19 - -
- (4893045) 4893045..4893110 + 66 NuclAT_20 - -
- (4893045) 4893045..4893110 + 66 NuclAT_20 - -
- (4893045) 4893045..4893110 + 66 NuclAT_20 - -
- (4893045) 4893045..4893110 + 66 NuclAT_20 - -
- (4893045) 4893045..4893110 + 66 NuclAT_21 - -
- (4893045) 4893045..4893110 + 66 NuclAT_21 - -
- (4893045) 4893045..4893110 + 66 NuclAT_21 - -
- (4893045) 4893045..4893110 + 66 NuclAT_21 - -
- (4893045) 4893045..4893110 + 66 NuclAT_22 - -
- (4893045) 4893045..4893110 + 66 NuclAT_22 - -
- (4893045) 4893045..4893110 + 66 NuclAT_22 - -
- (4893045) 4893045..4893110 + 66 NuclAT_22 - -
- (4893045) 4893045..4893110 + 66 NuclAT_23 - -
- (4893045) 4893045..4893110 + 66 NuclAT_23 - -
- (4893045) 4893045..4893110 + 66 NuclAT_23 - -
- (4893045) 4893045..4893110 + 66 NuclAT_23 - -
QJP60_RS23710 (4893400) 4893400..4894500 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP60_RS23715 (4894770) 4894770..4895009 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP60_RS23720 (4895158) 4895158..4895853 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP60_RS23725 (4895897) 4895897..4896250 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP60_RS23730 (4896435) 4896435..4897829 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280133 WP_001531632.1 NZ_CP124415:c4892995-4892888 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280133 NZ_CP124415:4893043-4893109 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References