Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4078551..4079230 | Replicon | chromosome |
| Accession | NZ_CP124415 | ||
| Organism | Escherichia coli strain AVS0223 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJP60_RS19565 | Protein ID | WP_000057523.1 |
| Coordinates | 4078551..4078853 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJP60_RS19570 | Protein ID | WP_000806442.1 |
| Coordinates | 4078889..4079230 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP60_RS19540 (4073927) | 4073927..4075579 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| QJP60_RS19545 (4075617) | 4075617..4076120 | - | 504 | WP_000667000.1 | hypothetical protein | - |
| QJP60_RS19550 (4076117) | 4076117..4076917 | - | 801 | WP_000439798.1 | hypothetical protein | - |
| QJP60_RS19555 (4076941) | 4076941..4077420 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJP60_RS19560 (4077624) | 4077624..4078418 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJP60_RS19565 (4078551) | 4078551..4078853 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJP60_RS19570 (4078889) | 4078889..4079230 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJP60_RS19575 (4079288) | 4079288..4081792 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJP60_RS19580 (4082054) | 4082054..4082986 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280132 WP_000057523.1 NZ_CP124415:4078551-4078853 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|