Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 94990..95232 | Replicon | plasmid pAVS0543-A |
| Accession | NZ_CP124411 | ||
| Organism | Escherichia coli strain AVS0543 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP61_RS24875 | Protein ID | WP_001372321.1 |
| Coordinates | 94990..95115 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 95192..95232 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP61_RS24830 (90102) | 90102..90329 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| QJP61_RS24835 (90417) | 90417..91094 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| QJP61_RS24840 (91228) | 91228..91611 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP61_RS24845 (91954) | 91954..92544 | + | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
| QJP61_RS24850 (92841) | 92841..93662 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| QJP61_RS24855 (93781) | 93781..94068 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJP61_RS24860 (94093) | 94093..94299 | - | 207 | WP_024217497.1 | hypothetical protein | - |
| QJP61_RS24865 (94369) | 94369..94542 | + | 174 | Protein_112 | hypothetical protein | - |
| QJP61_RS24870 (94540) | 94540..94770 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| QJP61_RS24875 (94990) | 94990..95115 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP61_RS24880 (95057) | 95057..95206 | - | 150 | Protein_115 | plasmid maintenance protein Mok | - |
| - (95192) | 95192..95232 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (95192) | 95192..95232 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (95192) | 95192..95232 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (95192) | 95192..95232 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (96676) | 96676..96862 | - | 187 | NuclAT_0 | - | - |
| - (96676) | 96676..96862 | - | 187 | NuclAT_0 | - | - |
| - (96676) | 96676..96862 | - | 187 | NuclAT_0 | - | - |
| - (96676) | 96676..96862 | - | 187 | NuclAT_0 | - | - |
| QJP61_RS24890 (96831) | 96831..97593 | - | 763 | Protein_117 | plasmid SOS inhibition protein A | - |
| QJP61_RS24895 (97590) | 97590..98024 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| QJP61_RS24900 (98079) | 98079..100037 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..135326 | 135326 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T280107 WP_001372321.1 NZ_CP124411:c95115-94990 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT280107 NZ_CP124411:c95232-95192 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
