Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67778..68017 | Replicon | plasmid pAVS0543-A |
| Accession | NZ_CP124411 | ||
| Organism | Escherichia coli strain AVS0543 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJP61_RS24720 | Protein ID | WP_023144756.1 |
| Coordinates | 67778..67912 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 67957..68017 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP61_RS24685 (63125) | 63125..63540 | - | 416 | Protein_76 | IS1-like element IS1B family transposase | - |
| QJP61_RS24690 (63789) | 63789..64190 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJP61_RS24695 (64123) | 64123..64380 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJP61_RS24700 (64473) | 64473..65126 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJP61_RS24705 (66066) | 66066..66923 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJP61_RS24710 (66916) | 66916..66990 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJP61_RS24715 (67227) | 67227..67481 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJP61_RS24720 (67778) | 67778..67912 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (67957) | 67957..68017 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (67957) | 67957..68017 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (67957) | 67957..68017 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (67957) | 67957..68017 | + | 61 | NuclAT_2 | - | Antitoxin |
| QJP61_RS24725 (67984) | 67984..68270 | - | 287 | Protein_84 | DUF2726 domain-containing protein | - |
| QJP61_RS24730 (68348) | 68348..69961 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJP61_RS24735 (69992) | 69992..70342 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP61_RS24740 (70339) | 70339..70764 | - | 426 | WP_000422741.1 | transposase | - |
| QJP61_RS24745 (71323) | 71323..71535 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QJP61_RS24750 (71666) | 71666..72226 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..135326 | 135326 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280103 WP_023144756.1 NZ_CP124411:c67912-67778 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280103 NZ_CP124411:67957-68017 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
