Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4918579..4918800 Replicon chromosome
Accession NZ_CP124410
Organism Escherichia coli strain AVS0543

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP61_RS23860 Protein ID WP_001531632.1
Coordinates 4918579..4918686 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4918734..4918800 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP61_RS23835 (4914423) 4914423..4915505 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP61_RS23840 (4915505) 4915505..4916338 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP61_RS23845 (4916335) 4916335..4916727 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP61_RS23850 (4916731) 4916731..4917540 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP61_RS23855 (4917576) 4917576..4918430 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP61_RS23860 (4918579) 4918579..4918686 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4918736) 4918736..4918799 + 64 NuclAT_12 - -
- (4918736) 4918736..4918799 + 64 NuclAT_12 - -
- (4918736) 4918736..4918799 + 64 NuclAT_12 - -
- (4918736) 4918736..4918799 + 64 NuclAT_12 - -
- (4918736) 4918736..4918799 + 64 NuclAT_13 - -
- (4918736) 4918736..4918799 + 64 NuclAT_13 - -
- (4918736) 4918736..4918799 + 64 NuclAT_13 - -
- (4918736) 4918736..4918799 + 64 NuclAT_13 - -
- (4918736) 4918736..4918799 + 64 NuclAT_14 - -
- (4918736) 4918736..4918799 + 64 NuclAT_14 - -
- (4918736) 4918736..4918799 + 64 NuclAT_14 - -
- (4918736) 4918736..4918799 + 64 NuclAT_14 - -
- (4918736) 4918736..4918799 + 64 NuclAT_15 - -
- (4918736) 4918736..4918799 + 64 NuclAT_15 - -
- (4918736) 4918736..4918799 + 64 NuclAT_15 - -
- (4918736) 4918736..4918799 + 64 NuclAT_15 - -
- (4918736) 4918736..4918799 + 64 NuclAT_16 - -
- (4918736) 4918736..4918799 + 64 NuclAT_16 - -
- (4918736) 4918736..4918799 + 64 NuclAT_16 - -
- (4918736) 4918736..4918799 + 64 NuclAT_16 - -
- (4918736) 4918736..4918799 + 64 NuclAT_17 - -
- (4918736) 4918736..4918799 + 64 NuclAT_17 - -
- (4918736) 4918736..4918799 + 64 NuclAT_17 - -
- (4918736) 4918736..4918799 + 64 NuclAT_17 - -
- (4918734) 4918734..4918800 + 67 NuclAT_10 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_10 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_10 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_10 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_5 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_5 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_5 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_5 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_6 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_6 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_6 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_6 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_7 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_7 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_7 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_7 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_8 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_8 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_8 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_8 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_9 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_9 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_9 - Antitoxin
- (4918734) 4918734..4918800 + 67 NuclAT_9 - Antitoxin
- (4918736) 4918736..4918801 + 66 NuclAT_18 - -
- (4918736) 4918736..4918801 + 66 NuclAT_18 - -
- (4918736) 4918736..4918801 + 66 NuclAT_18 - -
- (4918736) 4918736..4918801 + 66 NuclAT_18 - -
- (4918736) 4918736..4918801 + 66 NuclAT_19 - -
- (4918736) 4918736..4918801 + 66 NuclAT_19 - -
- (4918736) 4918736..4918801 + 66 NuclAT_19 - -
- (4918736) 4918736..4918801 + 66 NuclAT_19 - -
- (4918736) 4918736..4918801 + 66 NuclAT_20 - -
- (4918736) 4918736..4918801 + 66 NuclAT_20 - -
- (4918736) 4918736..4918801 + 66 NuclAT_20 - -
- (4918736) 4918736..4918801 + 66 NuclAT_20 - -
- (4918736) 4918736..4918801 + 66 NuclAT_21 - -
- (4918736) 4918736..4918801 + 66 NuclAT_21 - -
- (4918736) 4918736..4918801 + 66 NuclAT_21 - -
- (4918736) 4918736..4918801 + 66 NuclAT_21 - -
- (4918736) 4918736..4918801 + 66 NuclAT_22 - -
- (4918736) 4918736..4918801 + 66 NuclAT_22 - -
- (4918736) 4918736..4918801 + 66 NuclAT_22 - -
- (4918736) 4918736..4918801 + 66 NuclAT_22 - -
- (4918736) 4918736..4918801 + 66 NuclAT_23 - -
- (4918736) 4918736..4918801 + 66 NuclAT_23 - -
- (4918736) 4918736..4918801 + 66 NuclAT_23 - -
- (4918736) 4918736..4918801 + 66 NuclAT_23 - -
QJP61_RS23865 (4919091) 4919091..4920191 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP61_RS23870 (4920461) 4920461..4920700 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP61_RS23875 (4920849) 4920849..4921544 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP61_RS23880 (4921588) 4921588..4921941 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP61_RS23885 (4922126) 4922126..4923520 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280099 WP_001531632.1 NZ_CP124410:c4918686-4918579 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280099 NZ_CP124410:4918734-4918800 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References