Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4103942..4104621 | Replicon | chromosome |
| Accession | NZ_CP124410 | ||
| Organism | Escherichia coli strain AVS0543 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJP61_RS19725 | Protein ID | WP_000057523.1 |
| Coordinates | 4103942..4104244 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJP61_RS19730 | Protein ID | WP_000806442.1 |
| Coordinates | 4104280..4104621 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP61_RS19700 (4099318) | 4099318..4100970 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| QJP61_RS19705 (4101008) | 4101008..4101511 | - | 504 | WP_000667000.1 | hypothetical protein | - |
| QJP61_RS19710 (4101508) | 4101508..4102308 | - | 801 | WP_000439798.1 | hypothetical protein | - |
| QJP61_RS19715 (4102332) | 4102332..4102811 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJP61_RS19720 (4103015) | 4103015..4103809 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJP61_RS19725 (4103942) | 4103942..4104244 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJP61_RS19730 (4104280) | 4104280..4104621 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJP61_RS19735 (4104679) | 4104679..4107183 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJP61_RS19740 (4107445) | 4107445..4108377 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280098 WP_000057523.1 NZ_CP124410:4103942-4104244 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|