Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2899331..2899933 | Replicon | chromosome |
Accession | NZ_CP124410 | ||
Organism | Escherichia coli strain AVS0543 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QJP61_RS14060 | Protein ID | WP_000897302.1 |
Coordinates | 2899331..2899642 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QJP61_RS14065 | Protein ID | WP_000356397.1 |
Coordinates | 2899643..2899933 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP61_RS14035 (2895245) | 2895245..2895844 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
QJP61_RS14040 (2895838) | 2895838..2896710 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QJP61_RS14045 (2896707) | 2896707..2897144 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
QJP61_RS14050 (2897189) | 2897189..2898130 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QJP61_RS14055 (2898194) | 2898194..2899102 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
QJP61_RS14060 (2899331) | 2899331..2899642 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QJP61_RS14065 (2899643) | 2899643..2899933 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QJP61_RS14070 (2900292) | 2900292..2900570 | + | 279 | WP_001296612.1 | hypothetical protein | - |
QJP61_RS14075 (2900967) | 2900967..2901185 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
QJP61_RS14080 (2901370) | 2901370..2902110 | - | 741 | WP_000608806.1 | hypothetical protein | - |
QJP61_RS14085 (2902135) | 2902135..2902983 | - | 849 | WP_001038650.1 | hypothetical protein | - |
QJP61_RS14090 (2903273) | 2903273..2903515 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
QJP61_RS14095 (2903697) | 2903697..2904626 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280090 WP_000897302.1 NZ_CP124410:2899331-2899642 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|