Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 72957..73210 Replicon plasmid pAVS0935-B
Accession NZ_CP124407
Organism Escherichia coli strain AVS0935

Toxin (Protein)


Gene name srnB Uniprot ID A0A148HBD8
Locus tag QJB05_RS24895 Protein ID WP_001336447.1
Coordinates 73061..73210 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 72957..73013 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB05_RS24865 (68869) 68869..69615 + 747 WP_019842127.1 conjugal transfer pilus acetylase TraX -
QJB05_RS24870 (69670) 69670..70227 + 558 WP_000139329.1 fertility inhibition protein FinO -
QJB05_RS24875 (70379) 70379..70582 + 204 WP_001336517.1 hypothetical protein -
QJB05_RS24880 (71324) 71324..71785 + 462 WP_019842128.1 thermonuclease family protein -
QJB05_RS24885 (72054) 72054..72272 + 219 WP_023150739.1 hypothetical protein -
QJB05_RS24890 (72425) 72425..72862 + 438 WP_000872609.1 hypothetical protein -
- (72957) 72957..73013 - 57 NuclAT_1 - Antitoxin
- (72957) 72957..73013 - 57 NuclAT_1 - Antitoxin
- (72957) 72957..73013 - 57 NuclAT_1 - Antitoxin
- (72957) 72957..73013 - 57 NuclAT_1 - Antitoxin
QJB05_RS24895 (73061) 73061..73210 + 150 WP_001336447.1 Hok/Gef family protein Toxin
QJB05_RS24900 (73495) 73495..73752 + 258 WP_000084404.1 replication regulatory protein RepA -
QJB05_RS24905 (73857) 73857..74042 + 186 WP_012615301.1 plasmid copy control protein CopA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B - 1..74054 74054


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5572.69 Da        Isoelectric Point: 8.7678

>T280076 WP_001336447.1 NZ_CP124407:73061-73210 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 57 bp

>AT280076 NZ_CP124407:c73013-72957 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A148HBD8

Antitoxin

Download structure file

References