Detailed information of TA system TA280074

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 30306..30575
• Replicon: plasmid pAVS0935-B
• Accession: NZ_CP124407
• Organism: Escherichia coli strain AVS0935

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QJB05_RS24645
• Protein ID: WP_001372321.1
• Coordinates: 30450..30575 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	30306..30371 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QJB05_RS24605	25342..25773	-	432	Protein_32	hypothetical protein	-
QJB05_RS24610	26075..26602	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QJB05_RS24615	26660..26893	+	234	WP_000006003.1	DUF905 family protein	-
QJB05_RS24620	26954..28918	+	1965	WP_000117316.1	ParB/RepB/Spo0J family partition protein	-
QJB05_RS24625	28987..29421	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QJB05_RS24630	29418..30180	+	763	Protein_37	plasmid SOS inhibition protein A	-
-	30149..30373	+	225	NuclAT_0	-	-
-	30149..30373	+	225	NuclAT_0	-	-
-	30149..30373	+	225	NuclAT_0	-	-
-	30149..30373	+	225	NuclAT_0	-	-
QJB05_RS24635	30158..30337	-	180	WP_001309233.1	hypothetical protein	-
-	30306..30371	-	66	-	-	Antitoxin
QJB05_RS24640	30359..30508	+	150	Protein_39	plasmid maintenance protein Mok	-
QJB05_RS24645	30450..30575	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QJB05_RS24650	30894..31191	-	298	Protein_41	hypothetical protein	-
QJB05_RS24655	31491..31787	+	297	WP_001272251.1	hypothetical protein	-
QJB05_RS24660	31898..32719	+	822	WP_283187968.1	DUF932 domain-containing protein	-
QJB05_RS24665	33016..33525	-	510	WP_000759173.1	transglycosylase SLT domain-containing protein	-
QJB05_RS24670	33939..34322	+	384	WP_001151538.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QJB05_RS24675	34509..35198	+	690	WP_016239105.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B	-	1..74054	74054

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T280074 WP_001372321.1 NZ_CP124407:30450-30575 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT280074 NZ_CP124407:c30371-30306 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin