Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 49705..49944 | Replicon | plasmid pAVS0528-A |
| Accession | NZ_CP124401 | ||
| Organism | Escherichia coli strain AVS0528 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJP80_RS24515 | Protein ID | WP_023144756.1 |
| Coordinates | 49705..49839 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 49884..49944 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP80_RS24480 (45052) | 45052..45467 | - | 416 | Protein_51 | IS1-like element IS1B family transposase | - |
| QJP80_RS24485 (45716) | 45716..46117 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJP80_RS24490 (46050) | 46050..46307 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJP80_RS24495 (46400) | 46400..47053 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJP80_RS24500 (47993) | 47993..48850 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJP80_RS24505 (48843) | 48843..48917 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJP80_RS24510 (49154) | 49154..49408 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJP80_RS24515 (49705) | 49705..49839 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (49884) | 49884..49944 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (49884) | 49884..49944 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (49884) | 49884..49944 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (49884) | 49884..49944 | + | 61 | NuclAT_0 | - | Antitoxin |
| QJP80_RS24520 (49911) | 49911..50197 | - | 287 | Protein_59 | DUF2726 domain-containing protein | - |
| QJP80_RS24525 (50275) | 50275..51888 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJP80_RS24530 (51919) | 51919..52269 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP80_RS24535 (52266) | 52266..52691 | - | 426 | WP_000422741.1 | transposase | - |
| QJP80_RS24540 (53250) | 53250..53462 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QJP80_RS24545 (53593) | 53593..54153 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-27 | senB | 1..97703 | 97703 | |
| - | inside | IScluster/Tn | blaCTX-M-27 | - | 40384..52691 | 12307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280038 WP_023144756.1 NZ_CP124401:c49839-49705 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280038 NZ_CP124401:49884-49944 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|