Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4907890..4908111 Replicon chromosome
Accession NZ_CP124400
Organism Escherichia coli strain AVS0528

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP80_RS23755 Protein ID WP_001531632.1
Coordinates 4907890..4907997 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4908045..4908111 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP80_RS23730 (4903734) 4903734..4904816 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP80_RS23735 (4904816) 4904816..4905649 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP80_RS23740 (4905646) 4905646..4906038 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP80_RS23745 (4906042) 4906042..4906851 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP80_RS23750 (4906887) 4906887..4907741 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP80_RS23755 (4907890) 4907890..4907997 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4908047) 4908047..4908110 + 64 NuclAT_12 - -
- (4908047) 4908047..4908110 + 64 NuclAT_12 - -
- (4908047) 4908047..4908110 + 64 NuclAT_12 - -
- (4908047) 4908047..4908110 + 64 NuclAT_12 - -
- (4908047) 4908047..4908110 + 64 NuclAT_13 - -
- (4908047) 4908047..4908110 + 64 NuclAT_13 - -
- (4908047) 4908047..4908110 + 64 NuclAT_13 - -
- (4908047) 4908047..4908110 + 64 NuclAT_13 - -
- (4908047) 4908047..4908110 + 64 NuclAT_14 - -
- (4908047) 4908047..4908110 + 64 NuclAT_14 - -
- (4908047) 4908047..4908110 + 64 NuclAT_14 - -
- (4908047) 4908047..4908110 + 64 NuclAT_14 - -
- (4908047) 4908047..4908110 + 64 NuclAT_15 - -
- (4908047) 4908047..4908110 + 64 NuclAT_15 - -
- (4908047) 4908047..4908110 + 64 NuclAT_15 - -
- (4908047) 4908047..4908110 + 64 NuclAT_15 - -
- (4908047) 4908047..4908110 + 64 NuclAT_16 - -
- (4908047) 4908047..4908110 + 64 NuclAT_16 - -
- (4908047) 4908047..4908110 + 64 NuclAT_16 - -
- (4908047) 4908047..4908110 + 64 NuclAT_16 - -
- (4908047) 4908047..4908110 + 64 NuclAT_17 - -
- (4908047) 4908047..4908110 + 64 NuclAT_17 - -
- (4908047) 4908047..4908110 + 64 NuclAT_17 - -
- (4908047) 4908047..4908110 + 64 NuclAT_17 - -
- (4908045) 4908045..4908111 + 67 NuclAT_10 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_10 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_10 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_10 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_5 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_5 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_5 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_5 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_6 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_6 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_6 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_6 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_7 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_7 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_7 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_7 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_8 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_8 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_8 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_8 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_9 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_9 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_9 - Antitoxin
- (4908045) 4908045..4908111 + 67 NuclAT_9 - Antitoxin
- (4908047) 4908047..4908112 + 66 NuclAT_18 - -
- (4908047) 4908047..4908112 + 66 NuclAT_18 - -
- (4908047) 4908047..4908112 + 66 NuclAT_18 - -
- (4908047) 4908047..4908112 + 66 NuclAT_18 - -
- (4908047) 4908047..4908112 + 66 NuclAT_19 - -
- (4908047) 4908047..4908112 + 66 NuclAT_19 - -
- (4908047) 4908047..4908112 + 66 NuclAT_19 - -
- (4908047) 4908047..4908112 + 66 NuclAT_19 - -
- (4908047) 4908047..4908112 + 66 NuclAT_20 - -
- (4908047) 4908047..4908112 + 66 NuclAT_20 - -
- (4908047) 4908047..4908112 + 66 NuclAT_20 - -
- (4908047) 4908047..4908112 + 66 NuclAT_20 - -
- (4908047) 4908047..4908112 + 66 NuclAT_21 - -
- (4908047) 4908047..4908112 + 66 NuclAT_21 - -
- (4908047) 4908047..4908112 + 66 NuclAT_21 - -
- (4908047) 4908047..4908112 + 66 NuclAT_21 - -
- (4908047) 4908047..4908112 + 66 NuclAT_22 - -
- (4908047) 4908047..4908112 + 66 NuclAT_22 - -
- (4908047) 4908047..4908112 + 66 NuclAT_22 - -
- (4908047) 4908047..4908112 + 66 NuclAT_22 - -
- (4908047) 4908047..4908112 + 66 NuclAT_23 - -
- (4908047) 4908047..4908112 + 66 NuclAT_23 - -
- (4908047) 4908047..4908112 + 66 NuclAT_23 - -
- (4908047) 4908047..4908112 + 66 NuclAT_23 - -
QJP80_RS23760 (4908402) 4908402..4909502 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP80_RS23765 (4909772) 4909772..4910011 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP80_RS23770 (4910160) 4910160..4910855 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP80_RS23775 (4910899) 4910899..4911252 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP80_RS23780 (4911437) 4911437..4912831 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280034 WP_001531632.1 NZ_CP124400:c4907997-4907890 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280034 NZ_CP124400:4908045-4908111 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References