Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 4090515..4091194 | Replicon | chromosome |
Accession | NZ_CP124400 | ||
Organism | Escherichia coli strain AVS0528 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QJP80_RS19605 | Protein ID | WP_000057523.1 |
Coordinates | 4090515..4090817 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QJP80_RS19610 | Protein ID | WP_000806442.1 |
Coordinates | 4090853..4091194 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP80_RS19580 (4085891) | 4085891..4087543 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
QJP80_RS19585 (4087581) | 4087581..4088084 | - | 504 | WP_000667000.1 | hypothetical protein | - |
QJP80_RS19590 (4088081) | 4088081..4088881 | - | 801 | WP_000439798.1 | hypothetical protein | - |
QJP80_RS19595 (4088905) | 4088905..4089384 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QJP80_RS19600 (4089588) | 4089588..4090382 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QJP80_RS19605 (4090515) | 4090515..4090817 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJP80_RS19610 (4090853) | 4090853..4091194 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QJP80_RS19615 (4091252) | 4091252..4093756 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QJP80_RS19620 (4094018) | 4094018..4094950 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280033 WP_000057523.1 NZ_CP124400:4090515-4090817 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|