Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2885103..2885705 | Replicon | chromosome |
Accession | NZ_CP124400 | ||
Organism | Escherichia coli strain AVS0528 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QJP80_RS13955 | Protein ID | WP_000897302.1 |
Coordinates | 2885103..2885414 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QJP80_RS13960 | Protein ID | WP_000356397.1 |
Coordinates | 2885415..2885705 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP80_RS13930 (2881017) | 2881017..2881616 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
QJP80_RS13935 (2881610) | 2881610..2882482 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QJP80_RS13940 (2882479) | 2882479..2882916 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
QJP80_RS13945 (2882961) | 2882961..2883902 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QJP80_RS13950 (2883966) | 2883966..2884874 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
QJP80_RS13955 (2885103) | 2885103..2885414 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QJP80_RS13960 (2885415) | 2885415..2885705 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QJP80_RS13965 (2886064) | 2886064..2886342 | + | 279 | WP_001296612.1 | hypothetical protein | - |
QJP80_RS13970 (2886739) | 2886739..2886957 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
QJP80_RS13975 (2887142) | 2887142..2887882 | - | 741 | WP_000608806.1 | hypothetical protein | - |
QJP80_RS13980 (2887907) | 2887907..2888755 | - | 849 | WP_001038650.1 | hypothetical protein | - |
QJP80_RS13985 (2889045) | 2889045..2889287 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
QJP80_RS13990 (2889469) | 2889469..2890398 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280025 WP_000897302.1 NZ_CP124400:2885103-2885414 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|