Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 48232..48471 | Replicon | plasmid pAVS0972-A |
| Accession | NZ_CP124388 | ||
| Organism | Escherichia coli strain AVS0972 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJB01_RS24825 | Protein ID | WP_023144756.1 |
| Coordinates | 48232..48366 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 48411..48471 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB01_RS24790 (43579) | 43579..43994 | - | 416 | Protein_47 | IS1-like element IS1B family transposase | - |
| QJB01_RS24795 (44243) | 44243..44644 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJB01_RS24800 (44577) | 44577..44834 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJB01_RS24805 (44927) | 44927..45580 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJB01_RS24810 (46520) | 46520..47377 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJB01_RS24815 (47370) | 47370..47444 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJB01_RS24820 (47681) | 47681..47935 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJB01_RS24825 (48232) | 48232..48366 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (48411) | 48411..48471 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (48411) | 48411..48471 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (48411) | 48411..48471 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (48411) | 48411..48471 | + | 61 | NuclAT_0 | - | Antitoxin |
| QJB01_RS24830 (48438) | 48438..48724 | - | 287 | Protein_55 | DUF2726 domain-containing protein | - |
| QJB01_RS24835 (48802) | 48802..50415 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJB01_RS24840 (50446) | 50446..50796 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJB01_RS24845 (50793) | 50793..51218 | - | 426 | WP_000422741.1 | transposase | - |
| QJB01_RS24850 (51777) | 51777..51989 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QJB01_RS24855 (52120) | 52120..52680 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 | senB | 1..103452 | 103452 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280006 WP_023144756.1 NZ_CP124388:c48366-48232 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280006 NZ_CP124388:48411-48471 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
