Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2947574..2948176 | Replicon | chromosome |
| Accession | NZ_CP124387 | ||
| Organism | Escherichia coli strain AVS0972 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJB01_RS14310 | Protein ID | WP_000897302.1 |
| Coordinates | 2947574..2947885 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJB01_RS14315 | Protein ID | WP_000356397.1 |
| Coordinates | 2947886..2948176 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB01_RS14285 (2943488) | 2943488..2944087 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QJB01_RS14290 (2944081) | 2944081..2944953 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJB01_RS14295 (2944950) | 2944950..2945387 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJB01_RS14300 (2945432) | 2945432..2946373 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJB01_RS14305 (2946437) | 2946437..2947345 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJB01_RS14310 (2947574) | 2947574..2947885 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJB01_RS14315 (2947886) | 2947886..2948176 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJB01_RS14320 (2948535) | 2948535..2948813 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJB01_RS14325 (2949210) | 2949210..2949428 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJB01_RS14330 (2949613) | 2949613..2950353 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJB01_RS14335 (2950378) | 2950378..2951226 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJB01_RS14340 (2951516) | 2951516..2951758 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJB01_RS14345 (2951940) | 2951940..2952869 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T279993 WP_000897302.1 NZ_CP124387:2947574-2947885 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|