Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 35720..35974 | Replicon | plasmid pAVS0153-A |
| Accession | NZ_CP124386 | ||
| Organism | Escherichia coli strain AVS0153 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJP67_RS26395 | Protein ID | WP_001312851.1 |
| Coordinates | 35720..35869 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 35913..35974 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP67_RS26365 (30967) | 30967..31878 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QJP67_RS26370 (31889) | 31889..33109 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QJP67_RS26375 (33816) | 33816..34430 | + | 615 | Protein_40 | VENN motif pre-toxin domain-containing protein | - |
| QJP67_RS26380 (34430) | 34430..34876 | - | 447 | Protein_41 | plasmid replication initiator RepA | - |
| QJP67_RS26385 (34869) | 34869..34943 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| QJP67_RS26390 (35179) | 35179..35436 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QJP67_RS26395 (35720) | 35720..35869 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (35913) | 35913..35974 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (35913) | 35913..35974 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (35913) | 35913..35974 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (35913) | 35913..35974 | + | 62 | NuclAT_2 | - | Antitoxin |
| QJP67_RS26400 (36113) | 36113..36295 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QJP67_RS26405 (36396) | 36396..37012 | + | 617 | Protein_46 | IS1-like element IS1A family transposase | - |
| QJP67_RS26410 (37050) | 37050..38621 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| QJP67_RS26415 (38641) | 38641..38988 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP67_RS26420 (38988) | 38988..39665 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QJP67_RS26425 (39720) | 39720..39809 | + | 90 | Protein_50 | IS1 family transposase | - |
| QJP67_RS26430 (40110) | 40110..40322 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iutA / iutA / iutA / iucD | 1..108862 | 108862 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T279974 WP_001312851.1 NZ_CP124386:c35869-35720 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT279974 NZ_CP124386:35913-35974 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
