Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5210820..5211041 Replicon chromosome
Accession NZ_CP124385
Organism Escherichia coli strain AVS0153

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP67_RS25730 Protein ID WP_001531632.1
Coordinates 5210820..5210927 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5210975..5211041 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP67_RS25705 (5206664) 5206664..5207746 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP67_RS25710 (5207746) 5207746..5208579 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP67_RS25715 (5208576) 5208576..5208968 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP67_RS25720 (5208972) 5208972..5209781 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP67_RS25725 (5209817) 5209817..5210671 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP67_RS25730 (5210820) 5210820..5210927 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5210977) 5210977..5211040 + 64 NuclAT_12 - -
- (5210977) 5210977..5211040 + 64 NuclAT_12 - -
- (5210977) 5210977..5211040 + 64 NuclAT_12 - -
- (5210977) 5210977..5211040 + 64 NuclAT_12 - -
- (5210977) 5210977..5211040 + 64 NuclAT_13 - -
- (5210977) 5210977..5211040 + 64 NuclAT_13 - -
- (5210977) 5210977..5211040 + 64 NuclAT_13 - -
- (5210977) 5210977..5211040 + 64 NuclAT_13 - -
- (5210977) 5210977..5211040 + 64 NuclAT_14 - -
- (5210977) 5210977..5211040 + 64 NuclAT_14 - -
- (5210977) 5210977..5211040 + 64 NuclAT_14 - -
- (5210977) 5210977..5211040 + 64 NuclAT_14 - -
- (5210977) 5210977..5211040 + 64 NuclAT_15 - -
- (5210977) 5210977..5211040 + 64 NuclAT_15 - -
- (5210977) 5210977..5211040 + 64 NuclAT_15 - -
- (5210977) 5210977..5211040 + 64 NuclAT_15 - -
- (5210977) 5210977..5211040 + 64 NuclAT_16 - -
- (5210977) 5210977..5211040 + 64 NuclAT_16 - -
- (5210977) 5210977..5211040 + 64 NuclAT_16 - -
- (5210977) 5210977..5211040 + 64 NuclAT_16 - -
- (5210977) 5210977..5211040 + 64 NuclAT_17 - -
- (5210977) 5210977..5211040 + 64 NuclAT_17 - -
- (5210977) 5210977..5211040 + 64 NuclAT_17 - -
- (5210977) 5210977..5211040 + 64 NuclAT_17 - -
- (5210975) 5210975..5211041 + 67 NuclAT_10 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_10 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_10 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_10 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_5 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_5 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_5 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_5 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_6 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_6 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_6 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_6 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_7 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_7 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_7 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_7 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_8 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_8 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_8 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_8 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_9 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_9 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_9 - Antitoxin
- (5210975) 5210975..5211041 + 67 NuclAT_9 - Antitoxin
- (5210977) 5210977..5211042 + 66 NuclAT_18 - -
- (5210977) 5210977..5211042 + 66 NuclAT_18 - -
- (5210977) 5210977..5211042 + 66 NuclAT_18 - -
- (5210977) 5210977..5211042 + 66 NuclAT_18 - -
- (5210977) 5210977..5211042 + 66 NuclAT_19 - -
- (5210977) 5210977..5211042 + 66 NuclAT_19 - -
- (5210977) 5210977..5211042 + 66 NuclAT_19 - -
- (5210977) 5210977..5211042 + 66 NuclAT_19 - -
- (5210977) 5210977..5211042 + 66 NuclAT_20 - -
- (5210977) 5210977..5211042 + 66 NuclAT_20 - -
- (5210977) 5210977..5211042 + 66 NuclAT_20 - -
- (5210977) 5210977..5211042 + 66 NuclAT_20 - -
- (5210977) 5210977..5211042 + 66 NuclAT_21 - -
- (5210977) 5210977..5211042 + 66 NuclAT_21 - -
- (5210977) 5210977..5211042 + 66 NuclAT_21 - -
- (5210977) 5210977..5211042 + 66 NuclAT_21 - -
- (5210977) 5210977..5211042 + 66 NuclAT_22 - -
- (5210977) 5210977..5211042 + 66 NuclAT_22 - -
- (5210977) 5210977..5211042 + 66 NuclAT_22 - -
- (5210977) 5210977..5211042 + 66 NuclAT_22 - -
- (5210977) 5210977..5211042 + 66 NuclAT_23 - -
- (5210977) 5210977..5211042 + 66 NuclAT_23 - -
- (5210977) 5210977..5211042 + 66 NuclAT_23 - -
- (5210977) 5210977..5211042 + 66 NuclAT_23 - -
QJP67_RS25735 (5211332) 5211332..5212432 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP67_RS25740 (5212702) 5212702..5212941 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP67_RS25745 (5213090) 5213090..5213785 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP67_RS25750 (5213829) 5213829..5214182 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP67_RS25755 (5214367) 5214367..5215761 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T279970 WP_001531632.1 NZ_CP124385:c5210927-5210820 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT279970 NZ_CP124385:5210975-5211041 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References