Detailed information of TA system TA279945

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 97558..97827
• Replicon: plasmid unnamed
• Accession: NZ_CP124375
• Organism: Escherichia coli strain AVS0578

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QJP97_RS25945
• Protein ID: WP_001372321.1
• Coordinates: 97702..97827 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	97558..97623 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QJP97_RS25910	93393..93878	+	486	WP_042029316.1	single-stranded DNA-binding protein	-
QJP97_RS25915	93934..94167	+	234	WP_000006004.1	DUF905 domain-containing protein	-
QJP97_RS25920	94226..96184	+	1959	WP_282526072.1	ParB/RepB/Spo0J family partition protein	-
QJP97_RS25925	96239..96673	+	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
QJP97_RS25930	96670..97432	+	763	Protein_112	plasmid SOS inhibition protein A	-
QJP97_RS25935	97401..97589	-	189	WP_001299721.1	hypothetical protein	-
-	97401..97625	+	225	NuclAT_0	-	-
-	97401..97625	+	225	NuclAT_0	-	-
-	97401..97625	+	225	NuclAT_0	-	-
-	97401..97625	+	225	NuclAT_0	-	-
-	97558..97623	-	66	-	-	Antitoxin
QJP97_RS25940	97611..97760	+	150	Protein_114	plasmid maintenance protein Mok	-
QJP97_RS25945	97702..97827	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QJP97_RS25950	98047..98277	+	231	WP_001426396.1	hypothetical protein	-
QJP97_RS25955	98275..98448	-	174	Protein_117	hypothetical protein	-
QJP97_RS25960	98746..99033	+	288	WP_000107537.1	hypothetical protein	-
QJP97_RS25965	99154..99789	+	636	WP_139731638.1	DUF932 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A)	-	1..99789	99789

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T279945 WP_001372321.1 NZ_CP124375:97702-97827 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT279945 NZ_CP124375:c97623-97558 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin