Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5121143..5121745 | Replicon | chromosome |
| Accession | NZ_CP124374 | ||
| Organism | Escherichia coli strain AVS0578 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP97_RS25200 | Protein ID | WP_000897302.1 |
| Coordinates | 5121143..5121454 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP97_RS25205 | Protein ID | WP_000356397.1 |
| Coordinates | 5121455..5121745 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP97_RS25175 (5117057) | 5117057..5117656 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QJP97_RS25180 (5117650) | 5117650..5118522 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJP97_RS25185 (5118519) | 5118519..5118956 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP97_RS25190 (5119001) | 5119001..5119942 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP97_RS25195 (5120006) | 5120006..5120914 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP97_RS25200 (5121143) | 5121143..5121454 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP97_RS25205 (5121455) | 5121455..5121745 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP97_RS25210 (5122104) | 5122104..5122382 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP97_RS25215 (5122779) | 5122779..5122997 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP97_RS25220 (5123182) | 5123182..5123922 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP97_RS25225 (5123947) | 5123947..5124795 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP97_RS25230 (5125085) | 5125085..5125327 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP97_RS25235 (5125509) | 5125509..5126438 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T279939 WP_000897302.1 NZ_CP124374:5121143-5121454 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|