Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1237933..1238612 | Replicon | chromosome |
Accession | NZ_CP124374 | ||
Organism | Escherichia coli strain AVS0578 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QJP97_RS05945 | Protein ID | WP_000057523.1 |
Coordinates | 1237933..1238235 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QJP97_RS05950 | Protein ID | WP_000806442.1 |
Coordinates | 1238271..1238612 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP97_RS05920 (1233309) | 1233309..1234961 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
QJP97_RS05925 (1234999) | 1234999..1235502 | - | 504 | WP_000667000.1 | hypothetical protein | - |
QJP97_RS05930 (1235499) | 1235499..1236155 | - | 657 | WP_015674862.1 | hypothetical protein | - |
QJP97_RS05935 (1236323) | 1236323..1236802 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QJP97_RS05940 (1237006) | 1237006..1237800 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QJP97_RS05945 (1237933) | 1237933..1238235 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJP97_RS05950 (1238271) | 1238271..1238612 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QJP97_RS05955 (1238670) | 1238670..1241174 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QJP97_RS05960 (1241436) | 1241436..1242368 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T279921 WP_000057523.1 NZ_CP124374:1237933-1238235 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|