Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 117351..117584 | Replicon | plasmid pAVS0151-A |
| Accession | NZ_CP124373 | ||
| Organism | Escherichia coli strain AVS0151 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP92_RS26910 | Protein ID | WP_001372321.1 |
| Coordinates | 117351..117476 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 117553..117584 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP92_RS26870 (112725) | 112725..113414 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| QJP92_RS26875 (113601) | 113601..113984 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP92_RS26880 (114317) | 114317..114907 | + | 591 | WP_192849409.1 | transglycosylase SLT domain-containing protein | - |
| QJP92_RS26885 (115204) | 115204..116025 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| QJP92_RS26890 (116143) | 116143..116430 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJP92_RS26895 (116455) | 116455..116661 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| QJP92_RS26900 (116731) | 116731..116903 | + | 173 | Protein_138 | hypothetical protein | - |
| QJP92_RS26905 (116901) | 116901..117131 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| QJP92_RS26910 (117351) | 117351..117476 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP92_RS26915 (117418) | 117418..117567 | - | 150 | Protein_141 | plasmid maintenance protein Mok | - |
| - (117553) | 117553..117584 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (117553) | 117553..117584 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (117553) | 117553..117584 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (117553) | 117553..117584 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (119026) | 119026..119223 | - | 198 | NuclAT_0 | - | - |
| - (119026) | 119026..119223 | - | 198 | NuclAT_0 | - | - |
| - (119026) | 119026..119223 | - | 198 | NuclAT_0 | - | - |
| - (119026) | 119026..119223 | - | 198 | NuclAT_0 | - | - |
| QJP92_RS26925 (119035) | 119035..119223 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| QJP92_RS26930 (119192) | 119192..119954 | - | 763 | Protein_144 | plasmid SOS inhibition protein A | - |
| QJP92_RS26935 (119951) | 119951..120385 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| QJP92_RS26940 (120440) | 120440..120637 | - | 198 | Protein_146 | hypothetical protein | - |
| QJP92_RS26945 (120665) | 120665..120898 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| QJP92_RS26950 (120966) | 120966..121463 | - | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / tet(A) | senB / iutA / iutA / iucD | 1..150420 | 150420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T279909 WP_001372321.1 NZ_CP124373:c117476-117351 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT279909 NZ_CP124373:c117584-117553 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
