Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 77284..77538 | Replicon | plasmid pAVS0151-A |
| Accession | NZ_CP124373 | ||
| Organism | Escherichia coli strain AVS0151 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJP92_RS26665 | Protein ID | WP_001312851.1 |
| Coordinates | 77284..77433 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 77477..77538 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP92_RS26635 (72531) | 72531..73442 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QJP92_RS26640 (73453) | 73453..74673 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QJP92_RS26645 (75380) | 75380..75994 | + | 615 | Protein_87 | VENN motif pre-toxin domain-containing protein | - |
| QJP92_RS26650 (75994) | 75994..76440 | - | 447 | Protein_88 | plasmid replication initiator RepA | - |
| QJP92_RS26655 (76433) | 76433..76507 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| QJP92_RS26660 (76743) | 76743..77000 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QJP92_RS26665 (77284) | 77284..77433 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (77477) | 77477..77538 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (77477) | 77477..77538 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (77477) | 77477..77538 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (77477) | 77477..77538 | + | 62 | NuclAT_2 | - | Antitoxin |
| QJP92_RS26670 (77677) | 77677..77859 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QJP92_RS26675 (77960) | 77960..78576 | + | 617 | Protein_93 | IS1-like element IS1A family transposase | - |
| QJP92_RS26680 (78614) | 78614..80185 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| QJP92_RS26685 (80205) | 80205..80552 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP92_RS26690 (80552) | 80552..81229 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QJP92_RS26695 (81284) | 81284..81373 | + | 90 | Protein_97 | IS1 family transposase | - |
| QJP92_RS26700 (81674) | 81674..81886 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / tet(A) | senB / iutA / iutA / iucD | 1..150420 | 150420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T279905 WP_001312851.1 NZ_CP124373:c77433-77284 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT279905 NZ_CP124373:77477-77538 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
