Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3179196..3179798 | Replicon | chromosome |
| Accession | NZ_CP124372 | ||
| Organism | Escherichia coli strain AVS0151 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP92_RS16040 | Protein ID | WP_000897302.1 |
| Coordinates | 3179487..3179798 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP92_RS16035 | Protein ID | WP_000356397.1 |
| Coordinates | 3179196..3179486 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP92_RS16005 (3174503) | 3174503..3175432 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| QJP92_RS16010 (3175614) | 3175614..3175856 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP92_RS16015 (3176146) | 3176146..3176994 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP92_RS16020 (3177019) | 3177019..3177759 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP92_RS16025 (3177944) | 3177944..3178162 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP92_RS16030 (3178559) | 3178559..3178837 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP92_RS16035 (3179196) | 3179196..3179486 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP92_RS16040 (3179487) | 3179487..3179798 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP92_RS16045 (3180027) | 3180027..3180935 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP92_RS16050 (3180999) | 3180999..3181940 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP92_RS16055 (3181985) | 3181985..3182422 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP92_RS16060 (3182419) | 3182419..3183291 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJP92_RS16065 (3183285) | 3183285..3183884 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T279898 WP_000897302.1 NZ_CP124372:c3179798-3179487 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|